KEGG   Sphingomonas sp. MM-1: G432_11230Help
Entry
G432_11230        CDS       T02498                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sphm  Sphingomonas sp. MM-1
Pathway
sphm00620  Pyruvate metabolism
sphm00680  Methane metabolism
sphm01100  Metabolic pathways
sphm01120  Microbial metabolism in diverse environments
sphm01200  Carbon metabolism
Module
sphm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sphm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    G432_11230
  09102 Energy metabolism
   00680 Methane metabolism
    G432_11230
Enzymes [BR:sphm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     G432_11230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase EST1
Motif
Other DBs
NCBI-ProteinID: AGH49969
UniProt: M4S663
LinkDB All DBs
Position
complement(2362100..2364796)
Genome map
AA seq 898 aa AA seqDB search
MQRRRMRIAIPHTRQNPDIRFLGRLLGDVIRAYGGDALFRRVEYIRSASVDRHRGIAAPD
SIELGLDALTLDDTISFVRGFMLFSMLANLAEDRQGVAAEPGADVAQAIARLEAEGIDRD
RVTALLQQALVAPVLTAHPTEVRRKSTIDHRNHIAELMKLRDMGRTETDGGELVEEAIYR
QIALLWQTRPLRRERLYVADEVETALAYLRDVFLPVIPALHARWERALGQRPPSFLKPGS
WIGGDRDGNPNVTADSLRLALGRAAETVIGHYLDLLHRLGAELSISTELTPVTEEVIALA
ERSGDNSPSRSDEPFRRAITGVYSRLAATYRVLVGREPPRPPASADADPYVYPADFRADL
VAIAHALARDGDGALAGGGGLGRLIRAVETFGFHLATLDLRQNADVHERVVAELLNRAGV
EADYRALDEEGRVALLRRELASSRPLSSPYVTYSDETASELAIVHAAAEAHARYGAEAIT
TYIISKAESVSDLLEVHILLKEAGLYVPGDTPTSAIMVVPLFETIADLENAPKVMTAWFA
LPEAATITAARGVQEVMVGYSDSNKDGGYLTSVWSLHQASRALAPVFERAGAAMQLFHGR
GGAVGRGGGSSFMAIRAQPPGTVAGRIRITEQGEVIAAKYGTRESAVTNLEAMASATLLA
SLEPPQLAEAEYERFAGAMAKLSDTAFHAYRDLVYGTEGFRTFFRQFTPIAEIADLKIGS
RPASRTKSDRIEDLRAIPWVFSWAQARVMLPGWYGVGQALAAFEDRGLLAEMVEGWPFLQ
STLANLEMVLAKSDMEIAGHYVALVEDQAHGQAIFDRIRDGWHVTRDNLLDITGQSRLLE
KSPALDESIRLRLPYIEPLNHLQIELLKRHRAGEDDPRIHEGIQLSINAIATALRNSG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
ttgcagcgtcgccgcatgcgcatcgcgatcccccatacccgccagaaccccgacatccgc
ttcctcggccgcctgctcggcgacgtcatccgggcctatggcggcgacgcgctgttccgg
cgggtggaatatatccggtccgcctcggtcgaccggcatcgcggcatcgccgcgccggat
tcgatcgagctggggctggatgcgctcaccctcgacgacaccatctccttcgtgcgcggc
ttcatgctgttctcgatgctcgccaacctggccgaggaccggcagggcgtggcggccgag
ccgggggccgacgtcgcccaggcgatcgcgcggctggaggcggaggggatcgaccgcgat
cgggtgacggcgctgctacagcaggcgctggtggcgccggtgctgaccgcgcacccgacc
gaagtgcggcgcaagtccaccatcgaccaccgcaaccacatcgccgagctgatgaagctg
cgcgacatgggccgcacggaaaccgacggcggcgagctggtggaggaggcgatctaccgc
cagatcgcgttgctctggcagacgcggccgctgcggcgcgagcggctctatgtcgccgac
gaggtggagaccgcgctcgcctatctgcgcgacgtgttcctgcccgtcatccccgcgctc
cacgcccgctgggaacgcgcgctgggccagcgcccgcccagcttcctgaagccgggaagc
tggattggcggcgatcgcgacggcaatcccaacgtgacggccgattcgctgcggctggcg
ctgggccgggcggcggagaccgtgatcggccattatctcgacctgctgcaccggctgggc
gccgagctttcgatctcgaccgagctgacgcccgtgaccgaggaggtgatcgcgctggcc
gagcgcagcggcgacaattcccccagccgcagcgacgagcccttccgccgcgcgatcacc
ggcgtctattcgcggctggcggcgacctatcgcgtgctggttggtcgcgagccgccccgg
ccgccggcctcggccgatgccgatccttatgtctatccggccgacttccgcgccgatctg
gtcgcaatcgcccatgcgctggcccgcgacggcgatggcgcgctggcgggcggcggtggc
ttgggccggctgatccgcgcggtcgagaccttcggcttccacctcgccacgctcgacctg
cgccagaatgccgacgtgcacgagcgcgtggtggcggagctgctgaaccgcgccggcgtc
gaggcggattatcgcgcgctggacgaggaaggccgcgtcgccctgctgcggcgggagctg
gccagttcccgcccgctttccagcccctatgtcacctattcggacgagaccgcgtccgag
ctggcgatcgtccacgccgcggccgaggcgcacgcccgctacggggccgaggcgatcacc
acctacatcatctccaaggcggaaagcgtgtcggacctgctggaggtccatatcctcctc
aaggaagccggcctctacgtccccggcgacacgccgacctccgcgatcatggtggtgccg
ctgttcgagaccatcgccgacctcgaaaacgcgccgaaggtgatgaccgcctggttcgcc
ctgcccgaggccgcgacgatcaccgccgcgcgcggcgtgcaggaggtgatggtcggctat
tcggattcgaacaaggatggcggctacctcacctcggtgtggagcctgcaccaggcgagc
cgggcgctggcgccggtgttcgaacgcgcgggcgcggcgatgcagctgttccacggccgg
ggcggcgcggtgggccggggcggcggatcatccttcatggcgatccgcgcgcagccgccc
ggcacggtcgcgggccgcatccgcatcaccgagcagggcgaggtgatcgccgccaaatat
ggcacccgcgaaagcgccgtcaccaatctggaggccatggcatccgccaccttgctggcc
agcctggagccgccgcagctcgccgaggccgaatatgaacggttcgcgggcgcgatggcc
aagctttcggacaccgccttccacgcctatcgcgacctcgtctacggcaccgagggcttc
cgcaccttcttccgccagttcacgccgatcgccgagatcgccgacctcaagatcggatcg
cgccccgccagccgcaccaagagcgaccggatcgaggacctgcgcgccatcccctgggta
ttctcctgggcgcaggcccgcgtgatgctgcccggctggtatggcgtgggccaggcgctg
gcggcgttcgaggatcgcgggctgctggccgagatggtggagggctggcccttcctgcaa
tcgacgctggccaatctcgaaatggtgctcgccaagtccgacatggagattgccggccat
tatgtcgcgctggtcgaggatcaggcgcatggccaggcgatcttcgatcgcatccgcgac
ggctggcatgtcacgcgggacaatctgctcgacatcaccgggcagagccggctgctggaa
aagagcccggcgctcgacgaatcgatccggctccggctgccttatatagagccgctcaat
cacctgcagatcgagctgctgaagcgccatcgcgcgggcgaggacgatccccgcatccac
gaaggcatccagctttcgatcaacgccatcgccacggcgctgcgcaacagcgggtga

DBGET integrated database retrieval system