KEGG   Sphingomonas sp. MM-1: G432_19585Help
Entry
G432_19585        CDS       T02498                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sphm  Sphingomonas sp. MM-1
Pathway
sphm00010  Glycolysis / Gluconeogenesis
sphm00071  Fatty acid degradation
sphm00350  Tyrosine metabolism
sphm00625  Chloroalkane and chloroalkene degradation
sphm00626  Naphthalene degradation
sphm01100  Metabolic pathways
sphm01110  Biosynthesis of secondary metabolites
sphm01120  Microbial metabolism in diverse environments
sphm01130  Biosynthesis of antibiotics
sphm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sphm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G432_19585
  09103 Lipid metabolism
   00071 Fatty acid degradation
    G432_19585
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    G432_19585
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    G432_19585
   00626 Naphthalene degradation
    G432_19585
Enzymes [BR:sphm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     G432_19585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AGH51608
UniProt: M4S9J0
LinkDB All DBs
Position
pISP0:complement(84653..85678)
Genome map
AA seq 341 aa AA seqDB search
MAKTMKAAVVREFGKPLVIEDAPIPTVGPGQVLVKIAATGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGHVAAVGAGVTHVKEGDRVGVPWLYTACGHCVHCLGGWETLCHEQQNTGYSV
NGSFAEYVLADPNYVGHLPDNVDFLDIAPILCAGVTVYKGLKATEARPGEWVVVSGIGGL
GHMAVQYARAMGLNVAAVDIDDSKLDLATRLGATLTVNARNEDPSAALKKAIGGAHGALV
TAVSPKAFQQALGMVRRGGTVALNGLPPGDFPLSIFDTVLNGITVRGSIVGTRLDLLEAL
AFAGEGKVKATVHADKLENINDVFSRMHHGDIEGRIVLDLA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaccatgaaggcggcggtcgtccgcgaatttggcaagcccctggtcatcgag
gacgcgccgatcccgacggtcggccccgggcaggtcctggtcaagattgcggcaaccggc
gtgtgccataccgacctgcacgcggcagaaggggactggccggtcaagcccaacccgccc
ttcattcctggccatgagggcgtcgggcatgtcgccgccgttggtgccggcgtcacccat
gtgaaggaaggcgaccgggtcggtgtgccctggctctacaccgcctgcgggcactgcgtg
cattgcctgggtggctgggagacgctttgccacgaacagcagaacaccggctattcggtc
aatggcagctttgccgaatatgtcctcgccgatcccaactatgttggtcaccttcccgac
aatgtcgacttcctcgacattgcgccgatcctctgcgcgggcgtcaccgtctacaaggga
ttgaaggccaccgaggcccgacccggcgagtgggtggtcgtctccggcattggcgggctc
ggccacatggcggtgcaatatgcccgagccatgggtctcaatgtggccgcggtcgacatc
gacgatagcaagctcgacctcgctacacgccttggcgccacactgacggtcaacgcgcgc
aacgaggacccttcggcagcgctcaagaaagccattggcggcgcgcacggggcgctggtg
accgccgtttcgcccaaggcgttccagcaggcgctcggcatggtccggcgcggcggcacg
gtcgcgctcaacggcctgccgccgggcgacttcccgttgtcgatcttcgacaccgtgctg
aacggcattaccgtgcgcggctcgatcgtcggcacgcggctcgatctgctcgaggcactg
gcgttcgccggcgagggcaaggtcaaggccacggtccatgcagacaagctggagaacatc
aacgacgtcttctcccgcatgcatcatggcgacatcgagggccggatcgtcctcgacctc
gcctga

DBGET integrated database retrieval system