KEGG   Sphingobacterium sp. B29: BV902_06040Help
Entry
BV902_06040       CDS       T04670                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
sphn  Sphingobacterium sp. B29
Brite
Translation factors [BR:sphn03012]
 Eukaryotic Type
  Elongation factors
   BV902_06040
 Prokaryotic Type
   BV902_06040
Mitochondrial biogenesis [BR:sphn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BV902_06040
Exosome [BR:sphn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BV902_06040
  Exosomal proteins of breast cancer cells
   BV902_06040
  Exosomal proteins of colorectal cancer cells
   BV902_06040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: APU95955
UniProt: A0A1P8E211
LinkDB All DBs
Position
1445053..1446237
Genome map
AA seq 394 aa AA seqDB search
MAKEKFDRSKPHLNIGTIGHVDHGKTTTTAAITKVLADKGLSEARSFDSIDSAPEEKERG
ITINTAHVEYSTANRHYAHVDCPGHADYVKNMVTGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVGVPALVVFMNKTDLVDDPELLDLVEMEVRELLSFYEFPGDDIPVIKGSALGALN
GEPEWVEKIMELMDAVDNYIPIPPRLTDLPFLMPVEDVFSITGRGTVATGRIERGVINSG
DPVEILGMGAENLKSTVTGVEMFRKILDYGEAGDNVGLLLRGIEKTDIKRGMVICKPGSV
TPHDHFKAEVYVLSKAEGGRHTPFFNKYRPQFYFRTTDVTGEISLPEGTEMVMPGDNVTI
SVKLISAIAMEKGLRFAIREGGRTVGAGQVTEII
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagagaaatttgaccgtagtaaaccacacttaaacattggtactatcggtcac
gttgaccacggtaaaactacaactacagctgctatcactaaagtattggctgataaaggt
ttgtcagaagctcgttcatttgattcaattgactctgctcctgaagaaaaagagcgtggt
atcacaatcaatactgcacacgtagaatattctacagctaaccgtcactatgcacacgtt
gactgtccaggtcacgctgactacgttaagaacatggtaactggtgctgctcaaatggac
ggtgctatcatcgtagttgctgcgactgatggtcctatgcctcaaactcgtgagcacatc
ttgttggctcgccaagtaggtgttcctgcgttagtagtattcatgaacaaaactgactta
gttgatgaccctgagttgttagacttagttgaaatggaagttcgtgagttattatcattc
tacgaattccctggtgatgatatccctgtaatcaaaggttctgctttaggtgcattgaac
ggtgagcctgagtgggttgagaaaatcatggaattaatggatgctgtagataactacatt
ccaattcctccacgtttgactgacttacctttcttgatgccagtagaagacgtattctcg
atcacaggtcgtggtacagttgctacaggtcgtatcgaaagaggtgtaatcaactctggt
gatccagttgagatcttaggtatgggtgctgagaacttgaaatctacagtaacaggtgtt
gagatgttccgtaaaatcttagattacggtgaggctggtgataacgtaggtttattgtta
cgtggtattgagaaaactgatatcaaacgtggtatggttatctgtaaaccaggttcagta
actcctcacgatcatttcaaagctgaggtttacgtattgtcaaaagctgaaggtggtcgt
cacactccattcttcaacaaataccgtcctcaattctatttccgtacaactgacgtaact
ggagagatctctttaccagaaggtactgaaatggttatgccaggtgataacgttacaatc
agcgtgaaattaatttctgctattgcgatggaaaaaggtctacgtttcgctatccgtgag
ggtggtcgtacagtaggtgctggtcaggtaactgaaattatctag

DBGET integrated database retrieval system