KEGG   Sphingobacterium sp. B29: BV902_09560Help
Entry
BV902_09560       CDS       T04670                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sphn  Sphingobacterium sp. B29
Pathway
sphn00240  Pyrimidine metabolism
sphn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sphn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BV902_09560
Enzymes [BR:sphn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BV902_09560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK IMPDH
Motif
Other DBs
NCBI-ProteinID: APU96567
UniProt: A0A1P8E3T3
LinkDB All DBs
Position
complement(2310240..2310821)
Genome map
AA seq 193 aa AA seqDB search
MLFSEHNLALRPAQYGSIEIVCGSMFSGKTEELIRRLKRAQYARLNVEIFKPSVDKRYDE
KLVVSHDSNSIPSTPVDHSSAILLLSSSTQVVGIDEAQFFDDGLTEVCVKLANSGIRVIV
AGLDMDFQGQPFGPIPNLMAVAEHVTKVHAVCMQCGAPANYSYRLTKDTETVLLGEKDAY
EPRCRPCYFHLNK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgcttttttccgaacataatttggctttgcgccccgctcaatatggtagcattgaaatt
gtctgtggctcgatgttctcaggcaagacagaagaattgattcgcaggctcaaacgagca
caatatgcacgtttgaatgtcgaaatctttaaaccatctgttgacaaacgatacgatgaa
aagttggtcgtttctcacgatagtaatagcatcccgtcaacacccgttgatcattcttca
gcgatcctacttttgagttcatctacccaagttgtcggaatcgatgaggcacaatttttt
gatgacggtttgacagaggtgtgtgtcaaattggcaaatagtggtatccgggtaattgtt
gccgggctcgatatggattttcaagggcaaccatttggcccaattcccaatctaatggca
gtagccgaacacgttacgaaagtacatgcggtttgcatgcaatgtggcgctccagcgaat
tattcctatcgcctgaccaaggatacggaaaccgtacttttaggtgaaaaagacgcttat
gaaccacgttgtagaccctgttatttccatttgaataaatag

DBGET integrated database retrieval system