KEGG   Sphingobacterium sp. B29: BV902_09825Help
Entry
BV902_09825       CDS       T04670                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sphn  Sphingobacterium sp. B29
Pathway
sphn00564  Glycerophospholipid metabolism
sphn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sphn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BV902_09825
Enzymes [BR:sphn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BV902_09825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like GIDA Thi4 Pyr_redox_2 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: APU96608
UniProt: A0A1P8E3X2
LinkDB All DBs
Position
complement(2368357..2369934)
Genome map
AA seq 525 aa AA seqDB search
MKHQEFKRSKLIEKIRDTSAWDVIVIGGGASGLGVALDALSRGFKTILLEQVDFAKGTSS
KATKLVHGGVRYLAQGDIALVKEALHERGLLQKNAPHLVKNQSFIIPNYSWFDGPFYTIG
MKIYDLLAGKLSLGKSIHINKEETLNRISTVRPKGLYGGVVYQDGQFDDSRLALNVAQTC
IQMGGVALNYVRVNNLTKDSDGRINGVIANDTETGEVFTIQGKAIINATGIFVDDILKMD
RPEAKQMVRPSQGVHLVFDKSFLPGDDAIMIPKTDDGRVLFLVPWHNRVIVGTTDTPIDE
HSLEPVALEQEIDFILKTAGRYLTKQPTRADALAVFAGLRPLAAPTGNSNKTKEISRSHK
VIVSDSKLLTLTGGKWTTFRRMGQDTIDKAIKIGCLPQKESRSTTQKIYSAIPTSDRSNH
MYIYGADQEAINALAQENPEWNEKLIAHLEFKKAEVVWAARNELARTVEDVLSRRVRILF
LDAKAAIEAAPEVAKILAQELEKDQNWQNDQIAHFQKVAKNYILK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccaagaattcaaaaggtcaaaactgatagaaaaaataagagatacgagcgca
tgggatgttatcgtcataggtggcggtgccagcggattgggtgttgcattagatgcctta
agccgagggttcaaaacaattttgttggagcaggttgattttgcaaaaggaacttcgagc
aaagcaacgaagcttgttcacggtggtgtacgttacttggctcagggcgacatcgccctg
gttaaagaagcgcttcacgaaagaggtctacttcaaaaaaacgctccccatcttgtcaaa
aaccagtcctttatcatccccaattacagttggttcgatggcccattctataccatagga
atgaaaatatatgacctgctggcaggtaaattaagcttgggaaaatccattcatattaac
aaagaagaaacccttaaccgcataagcaccgttagacctaaagggctatatggcggcgtg
gtttatcaagacggacaatttgacgactcaagacttgcgctcaacgttgcgcaaacctgt
atacaaatgggcggcgtcgcgctgaattacgtaagagtcaataacctcaccaaagacagc
gatggacgaataaatggtgtcatcgctaatgataccgaaacgggggaagttttcaccata
caaggcaaggctattatcaatgctacaggaatatttgtcgatgacatcctaaaaatggac
agaccggaagcaaaacaaatggtacgccccagccaaggggttcacctggtatttgataaa
tcgtttcttcctggcgacgatgccattatgattccaaaaacggatgatggacgggtcctt
ttcctggtaccctggcacaatcgggtcattgtgggaacaacggacacaccaatagacgag
catagccttgaaccggtagctttggagcaggagatcgattttattctgaaaactgcggga
cgctacctgacaaaacaaccaacaagagcggatgcattggccgtattcgccggcctacgt
ccgctagcagctcctacaggcaactccaacaaaaccaaagagatctcacgaagccacaag
gttatcgtcagcgactccaaattacttactttaacgggtggaaagtggacaacattccgt
cgaatgggccaagacaccatcgacaaagcgataaaaatcggttgtttaccacaaaaagaa
agccggtctaccactcaaaagatttatagcgccattccgacatcagacagaagcaatcat
atgtatatttatggcgccgaccaagaagcgatcaacgcattggcgcaggaaaatccggaa
tggaacgaaaaattaatagcacatcttgaattcaaaaaggctgaagttgtttgggcggca
cgcaatgaacttgccagaactgtggaagatgtcctatcccgtcgagtacggatactattt
cttgatgcgaaagctgcaattgaagctgctcctgaagtcgcaaaaatactcgcacaggag
ctggaaaaagatcaaaattggcaaaatgatcaaatagcgcattttcaaaaagttgcaaaa
aattatatcttaaagtaa

DBGET integrated database retrieval system