KEGG   Sphingobacterium sp. B29: BV902_20470Help
Entry
BV902_20470       CDS       T04670                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sphn  Sphingobacterium sp. B29
Pathway
sphn03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sphn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BV902_20470
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sphn03400]
    BV902_20470
Enzymes [BR:sphn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BV902_20470
DNA repair and recombination proteins [BR:sphn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BV902_20470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: APU98421
UniProt: A0A1P8E974
LinkDB All DBs
Position
complement(4750406..4753144)
Genome map
AA seq 912 aa AA seqDB search
MGLSKYREKRSAGKTPEPFGGRSSGKELRFVVQMHDASHLHYDFRLEMNGVLKSWAVPKG
PSMDPSIKRLAMMVEDHPYDYRNFEGIIPKGQYGGGSVIVWDEGRYEALAPESNDVVKMD
KNLRHQLYSGKLKFRLYGEKLKGEFALVKAYGRGGNEWLLMKLEDQYATSKDVIANDKSV
LSGKTIAEMEKSPDKVYGQPVVKKNSISKNKGKKSRNAAEIISNQLEEVPKKKKAETQKQ
AYNITDLLKKSPKQVFYTTVQPMLATLVDKSFDDQSWVYEVKWDGYRAVAFMKNGEIELK
SRNDKSFNEKFYPVYDTLKSIAINAILDGEIVVLEKNGTANFAALQNWRSEADGDLVYYV
FDILWYDGKDLKGLSLLERKAILKEVIPQNDLILLSEHFDTSGVGFLNEAKKLGLEGIMA
KRKESVYHIHERSPDWLKIKANRRQEVVIGGFTKNEGSSKLFSSLLVGLYEDKKLIYTGK
VGTGFSAKLQQELMAQFKPLVTKNSPFDDEPDINKSSRFRPRPPHAAVTWLHPNLVCEVS
FTEMTGDGVMRHPSFVGMRNDKNAKKVILEEELAVNEIIGEQSKEGDGMRKNSKEGSSDK
KNYKTMLNPKDKTQVQKVNGHELKFTNLDKLFWPDEKITKRDLINYYEQAAPFILPYLKD
RPQSMNRYPNGIKEEGFYFKDVTDTAPEWAETYLYQSEADGRDRHYLVGKDEATLLYMAN
LGCIEMNPWSSTVGKPDNPTFCIIDLDPDKNTFDQVIETAQLTKQLLDDMAVPSYCKTSG
STGLHIYIPLGNKYNYDQSKEFAHIIVTLIHAELPDYTSLERTVRARKGKMYLDFLQNRP
HATIAAAYSVRPKPGATVSMPLYWDEVKKGLKISDFTLFNAIERMHEQGDIFKPVLGKGI
DLKKVIDTLSKK
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgtcaaaatatcgcgaaaagcgttccgcaggaaaaacaccggaaccctttgga
ggtagatcaagtggaaaggagttgcggttcgtcgtgcagatgcatgatgcttcgcatctg
cattatgatttccggcttgaaatgaacggggtgctcaaaagttgggcggttcccaagggg
ccatctatggatccatctattaaacgcttggccatgatggttgaagatcatccttatgat
taccggaattttgaaggtatcataccaaaaggacagtatgggggtggctcagttatcgtg
tgggatgaagggcgatatgaagctttagctcctgagagcaatgatgttgtaaaaatggat
aagaatcttcgacatcagctttatagcggaaagctcaaattcagattgtatggagaaaaa
ttgaagggagaatttgctttggtaaaagcatacggaagaggaggaaatgaatggctattg
atgaagttggaagatcaatatgcaacaagcaaggatgtcatagcaaatgataaatccgta
ttgtcgggaaagacgatagcggaaatggaaaaatcgcccgataaagtctatggacagcca
gttgttaaaaagaatagcatatcaaaaaataaaggcaagaaaagcaggaatgctgctgaa
ataatcagtaaccagttggaagaagtgcctaaaaagaaaaaggctgagacgcagaaacaa
gcgtataatatcaccgacttgctaaagaaatcaccgaagcaggtcttttatactacggtg
cagcccatgctggcgacgctggtcgacaagtcttttgatgatcaaagctgggtatacgaa
gtgaaatgggacggttatcgtgctgttgcctttatgaaaaatggcgaaatagaactaaaa
tctagaaatgacaaaagcttcaatgaaaagttttatccagtatatgataccctgaaaagc
atcgcgatcaatgccatactcgatggcgagatcgttgtattggaaaaaaatggaaccgcc
aactttgcggccctacaaaactggagaagtgaggcggatggcgatttggtatattatgta
tttgacatcctttggtacgatggaaaagatctaaaaggtctttcgctattggaaagaaaa
gcgattttaaaggaagtaataccgcaaaacgatttgattttattgagtgaacatttcgat
acatcgggcgttggatttttgaatgaagccaaaaaactcggtcttgagggtattatggcc
aaacgcaaggaaagcgtttaccatatacatgagcgttcacctgactggttgaaaataaag
gctaataggcgtcaggaggttgttattggcggttttacaaagaacgaaggctccagcaaa
ctgtttagtagcctattagtaggcttatatgaagataaaaagcttatttataccggaaag
gtcggaacaggattcagtgcaaaattacaacaagagctgatggcgcagttcaaacccttg
gtcacaaaaaatagcccgtttgatgacgaacccgatatcaacaaatcctcacgatttaga
ccccgccctcctcacgccgctgtcacctggctacatcccaacctggtttgcgaagtgagc
tttacagaaatgaccggggacggcgttatgcgacatccctcatttgtcggcatgcgtaac
gataaaaatgccaaaaaagtgattctagaagaagagttggctgttaatgagattatcggc
gaacaatcaaaagagggagatgggatgcgaaaaaatagtaaggaaggcagttcggataag
aaaaactataaaacaatgctaaaccccaaagacaaaacccaggttcagaaggtaaatgga
catgagttaaaatttaccaacctcgataaactattttggcctgacgaaaagatcaccaag
cgcgatttaattaattactatgagcaggctgcaccgtttattttaccataccttaaagat
cgaccacaaagtatgaatcgatacccaaatggtatcaaagaagaagggttctatttcaag
gatgttaccgatacagcaccggaatgggcagaaacctatctttaccaaagtgaggccgat
ggccgtgatcggcattatctggtcggaaaagacgaggctacattgttatatatggctaat
cttggctgtattgaaatgaatccctggagtagtaccgtcggaaaaccggataatccgacc
ttttgtatcattgatctggatccggataaaaatacatttgatcaagttattgaaaccgcc
cagctcaccaaacaacttttagatgatatggcggtaccttcgtattgtaaaacaagtggt
tccactggacttcacatatatataccattaggaaataaatataattacgatcagtccaag
gagtttgcgcatattattgtcaccctgattcatgcggagctacccgactataccagctta
gagcgaactgttcgtgctcggaaaggtaaaatgtatcttgattttcttcaaaatagacca
catgctaccattgctgcagcatattcagtacgtcccaagcctggagcgacagtgtccatg
ccattatattgggatgaagttaaaaaagggttgaaaattagtgatttcaccttgtttaat
gcgattgaaagaatgcatgagcagggtgatatctttaaacctgtattggggaaagggatc
gatctgaaaaaagtaattgatacactctcaaaaaaatag

DBGET integrated database retrieval system