KEGG   Sphingobacterium sp. B29: BV902_23475Help
Entry
BV902_23475       CDS       T04670                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sphn  Sphingobacterium sp. B29
Pathway
sphn00473  D-Alanine metabolism
sphn01100  Metabolic pathways
sphn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sphn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BV902_23475
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BV902_23475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sphn01011]
    BV902_23475
Enzymes [BR:sphn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BV902_23475
Peptidoglycan biosynthesis and degradation proteins [BR:sphn01011]
 Precursor biosynthesis
  Racemase
   BV902_23475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: APU98927
UniProt: A0A1P8EAK4
LinkDB All DBs
Position
complement(5470730..5473171)
Genome map
AA seq 813 aa AA seqDB search
MYKISEIAQILHPNRTFITDPNSFVQHLFYDSRKIAQADNGIFFALQKNRDGHRYIREAY
EKGVRNFVLQAEEGQEMELLEANILWVSDSLVAMQELATFHRQKFDYPFIGITGSNGKTI
VKEWLFQLMSPEYKIYRSPKSYNSQLGVALSLWGLSDQYNLALIEAGISEKGEMLRLEQM
IKPTIGLLTNIGVAHKAGFKSKEEKIYEKLELFKNVETMIFPNSYLENIQLPYRPRKFSW
GLDEGLSLEVYSIKQVNDRFTMVTFYYTGRTFAVEVPFVDKGNVENAINCVAVMLRFGYE
NEVIASRIKELQPVAMRLELKKGKKNSSIIDDSYSNDLDALQIALEFLNQQGQHPFKMLI
LSDIPGVHIEDEKSLSKLKRLLREYRLDKLILIGEVLPKVASQFDVPSISYSDTTAFLAD
IRSLSFENATVLLKGGREFHFERISQLLVAKSHDTVLEINLNALENNLNVYRQLLPKQVK
LMTMVKAFSYGSGSFEIANLLQFNRVDYLTVAFADEGVDLRGAGIKLPIVVMSPDESSFE
SIVQYNLEPEIYSFRILFSFLNFLKTKQIASFPIHIKIDTGMHRLGFMPDEVDRLIAVLR
AEAILEVKSAFSHLASAGNEKDREFTQRQIDLLDEFTKRLESGIGYSFLRHIAATSGIEL
WPNAYFDMVRLGIGLYGIDIERHDLPIREASTLKTNVTQIKYLPAGETVGYNRHGVLYRD
SKIATIKIGYADGYDRRFGNGVGKMLINGFLVPTIGDICMDMCMLDVTGVEVGEEDEVIV
YPDIKSAAKAIGTIPYELLTSISQRVKRVYFYE
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaatatcggaaatcgcccagattttacatcctaatcgcacatttataacggat
cctaattcttttgtccagcatttattttatgacagccgtaaaattgcccaggcggacaac
gggattttttttgcacttcagaagaacagagatggtcatcggtatatccgggaagcctac
gaaaaaggagttcgtaattttgtgcttcaggccgaggagggacaggaaatggagcttttg
gaagctaatattctttgggtatcggatagtttagttgctatgcaggagctggcaactttt
catcgtcagaaatttgattatcctttcatcggaattactgggagcaatggcaaaacgatt
gtaaaagagtggcttttccagcttatgtctcctgaatataagatttaccgaagtcctaag
agctataattctcaacttggtgtggctttgtccttgtggggattgtccgatcagtataat
cttgcgctaatcgaagcggggatttcagaaaagggggaaatgctgcgccttgagcagatg
ataaaaccaactataggactattaaccaacatcggtgttgcccataaagctggtttcaaa
tctaaggaggaaaagatttatgaaaagctcgagctttttaaaaatgttgaaactatgatt
tttccaaatagttacctcgaaaatattcaattgccatatagaccacgaaaattttcttgg
gggcttgatgagggcctttcgttggaagtatactccatcaaacaggttaacgaccgattt
actatggtcacgttctattataccggtcgcacctttgctgttgaagtaccgtttgtggat
aaaggtaatgttgagaacgcgataaattgtgtagcggtgatgctacgttttggttatgaa
aatgaagtgatcgcatcgaggattaaagagttgcagccagtggcgatgcgtcttgaatta
aaaaaaggaaaaaagaatagctccattatcgatgactcgtatagtaatgatctagatgcg
ttgcagatagccctggagtttttaaatcagcaggggcagcatccgttcaagatgttgata
ttgtcggatatccctggtgtccatatcgaagatgaaaaaagtttgtccaagctgaaacgt
ttgcttcgtgagtatcgtttggataaattgatattgataggcgaagtgttgcctaaagtg
gcatcacaatttgatgtgccttctatttcatatagcgatacaactgctttcttggccgat
attaggtcgctttcttttgaaaatgccacggtgttattgaaaggaggacgtgagtttcat
tttgaacgtatcagtcagcttttagttgcaaaatcgcatgatacagtgcttgaaatcaat
ttgaatgcactcgagaataatttgaacgtatatcgacagctgctgccgaaacaggtgaag
ttgatgaccatggtcaaagctttttcttatggtagtggaagcttcgagatcgcaaatctt
ttgcaattcaatcgggtggattatctgacggttgcttttgcggatgagggagttgatttg
cgtggtgcgggcataaaattacctattgtagtgatgagccctgatgaaagttcttttgag
tccattgttcagtataaccttgaaccggaaatttatagctttagaatattgttctccttt
ttgaattttctgaaaacgaaacaaatagcttcttttccgattcatattaagatagataca
ggtatgcatcggttgggttttatgcctgacgaggtcgatcgtttaatagcggtgctacgt
gcggaagcgattttagaggttaaatctgcattttcccacttagcgtctgcaggtaatgaa
aaggatcgggaatttacacaacgacaaattgatctgctggatgagtttacaaagcgtctc
gaaagtggtataggatattcttttctacgtcatattgcagcaacatcgggtattgaattg
tggccgaatgcatattttgatatggtgaggttggggatagggctctatggtatcgatatt
gagcgccatgatttacccattagggaggcgagtaccttgaaaacgaatgtgacacagatt
aaatacctcccggcaggtgaaaccgtaggttataataggcacggcgtcctgtatagagac
agtaagattgcgacaattaaaattggttatgcggacggttacgataggcgttttggtaac
ggtgtgggtaaaatgttgataaacgggtttttagtccctactataggtgatatatgtatg
gatatgtgcatgttggatgttacgggtgtggaagttggagaggaagatgaagttatcgtg
taccctgatataaagtcagcggcgaaagctataggaacgattccttatgaactgctgacg
agtatttcccaacgcgtaaaaagagtatatttttatgaataa

DBGET integrated database retrieval system