KEGG   Sphingopyxis sp. MG: C3E99_01645Help
Entry
C3E99_01645       CDS       T05382                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
spho  Sphingopyxis sp. MG
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC PE
Motif
Other DBs
NCBI-ProteinID: AVA12720
UniProt: A0A2L0VLF7
LinkDB All DBs
Position
355131..356594
Genome map
AA seq 487 aa AA seqDB search
MNDHRRIAPVARPDALYIDGAWTRASTGRRIAVADAATATVFMEVAEAGTDDIALAVRAA
REAFDAGPWTQMTHDERAAYLRAIADRLEGRLADLKSLWIAETGITTTHADRVMPSIPDG
FRSYAGLADSFPFSEEHASSVGGRALLLREPVGVVAAIIPWNAPVSMIMHKCAPALLAGC
TIVLKASPEAPGAAYIFAEICDEVGLPRGVVNMVTADRHASDALVRDPLVDKISFTGSTE
VGQHIGAVCGSRVARCTLELGGKSAAIVLDDFDIGQAAATIAGGATFLSGQVCAALTRVV
VRRDRHDAMVEALRSAFETVRVADPFDPATGMGPVASERQRARIEQYVEGAVAEGATLAC
GGARPSNGLDGFFVAPTVFGHVSNAMTIAREEVFGPVLSVIPCADEREAVALANDSLYGL
NAAVFTASADRALDVARQIRAGSVGHNGSRPDFGIAFGGFKRSGIGREGGAEGLRSFLET
KTVVLAP
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgatcaccggcggatcgcccccgtggcgcggcccgacgcgctctatatcgacggg
gcgtggacgcgcgcctcgacgggccggcggatcgcggtcgcggatgcggccaccgcaaca
gtcttcatggaggtggccgaggccggaaccgacgacatcgcgctggctgtgcgggcggcg
cgggaggcattcgacgcgggcccctggacgcagatgactcacgacgagcgggccgcttat
cttcgcgcgatcgcggaccggctggaggggcggctcgccgacctcaagtcgctctggatc
gcggagacgggcatcacgaccacgcatgccgaccgggtcatgccttcgatccccgacggc
tttcgctcctatgccggcctcgccgacagctttcccttcagcgaggagcacgcctcctcc
gtgggcggccgtgccttgctcctgcgcgagcccgtcggcgtcgtcgccgcgatcattccc
tggaacgcgcccgtttcgatgatcatgcacaaatgcgcgccggcgcttctcgccggctgc
acgatcgtcctgaaggcgtcgccggaagcgccgggcgccgcctatatctttgccgaaatc
tgcgacgaggtggggttgccccgcggcgtggtcaacatggtcaccgctgaccggcacgcg
tccgatgccctggtgcgcgacccgctggtcgacaagatatcgttcaccggatcgaccgag
gtaggccagcatatcggcgcggtgtgcggttcccgcgtcgcgcgctgcacgctcgagctg
ggggggaagtccgccgcgatcgttctcgacgatttcgacatagggcaggcggccgccacg
atcgccggcggcgccaccttcctctccggccaggtgtgcgctgcgctgacgcgggtggtc
gtccgccgcgaccggcacgatgccatggtggaggcgctccgttcggctttcgaaaccgtc
cgggtcgccgatcccttcgatcctgcgacgggcatggggccggtggcgagcgagcggcag
cgcgcgcggatcgagcaatatgtcgaaggggcggttgcggagggcgccacgctggcgtgc
ggcggcgcgcgtccctccaacggcctggacggctttttcgtggcgccgacggtgttcggc
catgtatcgaacgccatgacgatcgcgcgcgaggaggtgttcgggccggtgctttcggtc
attccctgcgccgacgaacgcgaggccgtcgcgctcgcgaacgacagcctgtacgggctg
aacgccgccgtgttcaccgcttccgccgaccgcgccctcgacgtggcccggcagattcgc
gccggcagcgtcgggcataatggttcgcggcccgatttcggcatcgcattcggcggcttc
aagcgatcgggaatcggtcgcgaaggcggcgcggagggcctgcggtcgttcctcgaaacg
aagacggtcgttttggcgccctga

DBGET integrated database retrieval system