KEGG   Sphingopyxis sp. MG: C3E99_06330Help
Entry
C3E99_06330       CDS       T05382                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
spho  Sphingopyxis sp. MG
Brite
KEGG Orthology (KO) [BR:spho00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:spho02022]
    C3E99_06330
Two-component system [BR:spho02022]
 OmpR family
  Unclassified
   C3E99_06330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AVA13511
UniProt: A0A2L0VNL0
LinkDB All DBs
Position
1380801..1381535
Genome map
AA seq 244 aa AA seqDB search
MTDSDTPRILLIDDEPSIREPLSEYLEGQGFAVSDAASAAEARSVLRAKSIDLVVSDIMM
PGEDGLSLTRHLRETSHIPVILLTARAEDTERIIGLEIGADDYVVKPFNPRELVARIRTV
LRRTQANGRALDAGGTSYAFGPWVLREVERVLVDRDGREVALSSGEYHLLHALVRHPRQV
MSRDRLLDLVRGREADIFDRAIDNLVSRLRKKIEDDPARPQIVKTVWGGGYTLACEVKRL
DAAT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacagcgataccccccgcatcctgctgatcgacgacgagccgtcgatccgcgag
ccgctgtccgagtatctggaaggacagggttttgccgtcagcgacgccgcgagcgcggcc
gaggcgcggtcggtgctgcgcgccaagagcatcgacctggtggtgagcgacatcatgatg
cccggcgaggacgggctgtcgctgacccgccacctgcgcgagacgagccatattcccgtc
atcctgctgaccgcgcgggccgaggacaccgaacggatcatcgggctggagatcggcgcc
gacgactatgtcgtcaaacccttcaacccgcgcgaactggtcgcgcgcatccgcaccgtg
ctgcgccggacgcaggcgaacggccgcgcgctcgacgccggcgggacgagctatgccttc
ggcccctgggtgctgcgcgaggtcgagcgcgtgctggtcgatcgcgacgggcgcgaggtg
gcgttgtcgtcgggcgaatatcacctgctccacgcgctggtgcgtcacccgcggcaggtg
atgagccgcgaccggctgctcgacctcgtgcgcgggcgggaggccgacattttcgaccgc
gcgatcgacaatctggtcagccgcctgcgcaagaagatcgaggacgatccggcgcggccg
cagatcgtcaagaccgtgtggggcggcggctatacgctggcgtgcgaggtcaagcggctg
gacgcggcgacatga

DBGET integrated database retrieval system