KEGG   Sphingopyxis sp. MG: C3E99_08965Help
Entry
C3E99_08965       CDS       T05382                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spho  Sphingopyxis sp. MG
Pathway
spho00010  Glycolysis / Gluconeogenesis
spho00020  Citrate cycle (TCA cycle)
spho00620  Pyruvate metabolism
spho01100  Metabolic pathways
spho01110  Biosynthesis of secondary metabolites
spho01120  Microbial metabolism in diverse environments
spho01130  Biosynthesis of antibiotics
spho01200  Carbon metabolism
Module
spho_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C3E99_08965
   00020 Citrate cycle (TCA cycle)
    C3E99_08965
   00620 Pyruvate metabolism
    C3E99_08965
Enzymes [BR:spho01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     C3E99_08965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 QRPTase_N RnfC_N DUF3597
Motif
Other DBs
NCBI-ProteinID: AVA13950
UniProt: A0A2L0VPW4
LinkDB All DBs
Position
complement(1915779..1917104)
Genome map
AA seq 441 aa AA seqDB search
MPIELKMPALSPTMEEGTLAKWLVKEGDTVQSGDLLAEIETDKATMEFEAIDEGTIAQIL
VPEGADNVKVGTVIAVIAGEGEDAGTAKAAPAPAPAAAASAPTPEPVRAEPVEAPSSSSA
TAAKKDGPSPGRDPGSGQMEKGERIKASPLARRIAAEKGIDLSAVNGSGPGGRIVKADLE
GAPATAAAPAQAAAATPAPAAAPQQAAPFETDIPHTADKLSNMRKTIARRLTEAKQTIPH
IYLTVDIQLDRLLKLRGELNAALEPQGIKLSVNDLLIKALAKALVQVPKCNVSFAGDQLI
SYSRADISVAVSVPAGLITPIIVGADEKSVSKISTEMKELAGRAKEGKLQPHEYQGGTAS
ISNMGMFGISQFDAVINPPQGMIMAIGAGEKRPWIVDDALAIATVMSATGSFDHRAIDGA
DGAQLMQAFKQIVENPLGLVA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgaactcaaaatgcccgccctttcgccgacgatggaggaggggacgcttgcc
aaatggctggtcaaggagggcgacacggtccagtcgggcgacctgctcgccgagatcgag
accgacaaggcgacgatggaattcgaagcgatcgacgagggcacgatcgcgcagattctc
gttcccgaaggcgccgacaatgtgaaggtcggaacggtgatcgcggtgatcgcgggcgag
ggcgaggatgcgggcacggcgaaggccgcgccggcgccggcacctgccgctgctgcttcc
gcacccacccctgaacccgttcgcgctgagcctgtcgaagcgccgtcctcctcttcggcg
accgccgcgaaaaaggacggtccttcccccggacgcgatccggggtcaggacaaatggag
aagggggagaggatcaaggccagcccgctcgccaggcgtatcgccgctgaaaagggcatc
gacctgtcggcggtcaatggcagcggccccggcggccgcatcgtcaaggccgacctcgag
ggcgcgcccgccaccgccgccgctccggcgcaagccgccgcggcgactccggccccagcc
gctgcgccgcagcaggcggcaccgttcgaaaccgatatcccgcataccgccgacaagctc
agcaacatgcgcaagacgatcgcgcgccgcctgaccgaggcgaagcagacgatcccgcac
atctacctgaccgtcgatatccagctcgaccggctgctcaaactgcgcggcgagctcaac
gcggcgctggaaccgcaggggatcaagctcagcgtcaacgacctgctcatcaaggcgctc
gccaaggcgctggttcaggtgcccaagtgcaacgtcagcttcgccggcgaccagctcatc
agctacagccgcgccgacatctcggtcgcggtcagcgtccccgccggcctcatcaccccg
atcatcgtcggcgccgacgagaaatcggtgagcaagatctcgaccgagatgaaggaactc
gcgggccgcgccaaggagggcaagctccagccccacgaatatcagggcggcaccgcgagc
atcagcaacatgggcatgttcggcatcagccagttcgacgcggtgatcaacccgccgcag
ggcatgatcatggcgatcggcgcaggcgagaaacggccgtggatcgtcgacgacgcgctg
gccatcgccacggtgatgtcggcaaccggcagcttcgaccaccgcgccatcgacggcgcc
gacggcgcgcaactgatgcaggcgttcaagcagatcgtcgaaaacccgctcggactggtg
gcgtaa

DBGET integrated database retrieval system