KEGG   Sphingopyxis sp. MG: C3E99_09315Help
Entry
C3E99_09315       CDS       T05382                                 

Definition
(GenBank) type 1 glutamine amidotransferase
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
spho  Sphingopyxis sp. MG
Pathway
spho00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spho01100  Metabolic pathways
spho01110  Biosynthesis of secondary metabolites
spho01130  Biosynthesis of antibiotics
spho01230  Biosynthesis of amino acids
spho02024  Quorum sensing
Module
spho_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spho00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C3E99_09315
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    C3E99_09315
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C3E99_09315
Enzymes [BR:spho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     C3E99_09315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 V4R
Motif
Other DBs
NCBI-ProteinID: AVA14010
UniProt: A0A2L0VQ21
LinkDB All DBs
Position
2001668..2002258
Genome map
AA seq 196 aa AA seqDB search
MILVIDNYDSFTFNLVHYLIELGAEVRVERNDALTAAEALASGAEAILISPGPCTPNEAG
ISLDLVAACADAARPLLGVCLGHQAIGQHFGGTVQRGHLMHGKTSPVCHDGTGLFAGLPS
PLTATRYHSLEVVDIPAALAINATSDDGAVMGFRHVELPIHGVQFHPESIATEHGHAMLA
NFMRLAGLPVAERQAA
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatcctggtcatcgacaattacgacagcttcaccttcaacctcgttcattatctgatc
gaactgggggcagaggtgcgcgtcgaacgcaacgatgcgctcaccgcagccgaggcgctg
gcgagcggcgccgaggcgatcctcatttcccccggcccctgtaccccgaacgaagccggg
atcagcctcgatctcgtcgccgcctgcgccgatgcggcacggccgctgctcggcgtatgc
ctcggtcatcaggcgatcggccagcatttcggcggcacggtgcagcgcggtcacctgatg
cacggcaagacctcgccggtgtgccacgacggcaccgggctgttcgccggcctgccctcg
ccgctcaccgcgacgcgctatcacagcctcgaagtggtcgacattcccgccgcgctcgcg
atcaatgcgacgagcgacgatggcgcggtgatgggctttcgccatgtcgaactgccgatc
cacggcgtgcagttccaccccgagagcatcgccaccgagcacggccacgcgatgctcgcc
aatttcatgcggctggcggggctgccggtcgccgagcggcaggcggcatga

DBGET integrated database retrieval system