KEGG   Sphingopyxis sp. MG: C3E99_12920Help
Entry
C3E99_12920       CDS       T05382                                 

Gene name
cobT
Definition
(GenBank) nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
spho  Sphingopyxis sp. MG
Pathway
spho00860  Porphyrin and chlorophyll metabolism
spho01100  Metabolic pathways
Module
spho_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:spho00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C3E99_12920 (cobT)
Enzymes [BR:spho01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     C3E99_12920 (cobT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT
Motif
Other DBs
NCBI-ProteinID: AVA14636
UniProt: A0A2L0VRU0
LinkDB All DBs
Position
complement(2808335..2809351)
Genome map
AA seq 338 aa AA seqDB search
MTAFASIADFEVALARPRNIDDEAQEAARARQMTLTKPAGSLGRLEDIAIFFAGWQSRAR
PRLDRARAVIFAGNHGVAVHGVSAFPSTVTAQMVANFEAGGAAINALSTTAGLELQIVAL
DLDRPTADFTAAPAMTPAECLDALNAGAAVVDEGIDMIVLGEMGIANSTAAAALCARSFG
GTAADWVGPGTGVDTQGVARKAKVVERAVAVHAHAGRSAFETLRRVGGRETAAIAGAAVR
ARQLGVPVLLDGFICCAAIAPLAADNPVIADHCIAGHCSAEPGHVLLLEKLGLDPLLSLG
MRLGEGSGAAVAAGVVRAALAAHDRMATFAEAAVSASL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctttgcctcgatcgcggatttcgaggtcgcgctggcgcgtccgcgcaatatc
gatgacgaagcgcaagaggctgcccgcgcgcgccagatgacgctgaccaagcccgccgga
tcgctggggcggctggaagacatcgccatcttcttcgccggctggcagtcgcgcgcgcgc
ccgcgcctcgaccgcgcgcgcgccgtgatcttcgccggcaatcacggcgtcgccgtgcac
ggcgtcagcgcttttccctcaaccgtcacggcccagatggtcgccaattttgaggcgggc
ggcgcggcgatcaacgcgctgtcgactactgccggactggaattgcagatcgtcgcgctc
gacctcgaccgaccgacagccgacttcaccgccgcacccgcgatgactccggccgaatgc
ctcgacgcgctcaacgccggggcggcggtcgttgacgaggggatcgacatgatcgtgctg
ggtgaaatggggatcgccaattcgaccgctgccgccgcgctatgcgcgcgcagcttcggc
ggcacggccgccgactgggtcggccccggcacgggcgtcgatactcagggcgtggcgcgc
aaggccaaggtggtcgagcgcgcggtcgccgtccatgcccatgccgggcgttcggcgttc
gagacgctgcgccgcgtcggcggccgcgagacggcggcgatcgccggcgcggcggtgcgg
gcgcggcaattgggcgttcccgtccttctcgacggcttcatctgctgcgcggcgatcgcg
ccgctggcggcggacaatccggtgatcgccgaccattgcatcgcgggccattgctcggcc
gagcccggccatgtgctgctgctcgaaaagcttgggctcgatccgctgctgtcgctcggg
atgcggctcggcgaagggagcggggcggcggtggcggccggggtcgtccgcgcggcactc
gccgcgcacgaccggatggcgacctttgccgaggccgcggtgtcggcatcgctatga

DBGET integrated database retrieval system