KEGG   Sphingopyxis sp. 113P3: LH20_01185Help
Entry
LH20_01185        CDS       T04069                                 

Definition
(GenBank) membrane protein
  KO
K07090  uncharacterized protein
Organism
sphp  Sphingopyxis sp. 113P3
Brite
KEGG Orthology (KO) [BR:sphp00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    LH20_01185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ALC10558
UniProt: A0A0M4CRI1
LinkDB All DBs
Position
complement(277040..277807)
Genome map
AA seq 255 aa AA seqDB search
MLDLAALDPTALLPFILIGFAAQLVDGALGMAFGVICNTLLVAVMGVPPAAASARIHVVE
VFTTGVSGISHLIHRNIEWGLFLKLLIPGLIGGVSGAYLLSSLHGDFVKPFVLTYLVAVG
VWLLVRGLLYPPKFRKPKVIAPLGLIGGFLDAAGGGGWGPVVTSNLLVQGAEPRKVVGTV
NSVEFFLTLAVSATFIWHLGLEDIAGATLGLLIGGVLAAPLGAVMAKRFSPKLMLILVGF
VLTATSAFGLYKVLA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatctggccgccctggatcccacggcgctcctgcccttcattctcatcggcttt
gcagcgcagctggtcgacggggcactggggatggcgttcggcgtcatctgcaacactctg
cttgtggcggtgatgggcgtgccgcccgcggcggcgtcggcgcgcattcatgtggttgag
gttttcaccaccggcgtgtcgggtatcagccacctgattcaccgcaacatcgagtggggc
ctcttcttgaagctgctgatccccggcctgatcggcggcgtgtcgggcgcctacctcttg
agttcgctccatggcgatttcgtcaagcctttcgtcctcacctacctggttgcggtcggc
gtctggcttcttgtccgcggtcttctctatccgcccaaatttcgcaagccgaaggtgatc
gcaccactcggactgatcggaggcttcctggacgccgcgggcggcggcgggtgggggccc
gtggtgacctcgaacctgctcgtccagggcgccgaaccgcgcaaggtcgtgggcacggtg
aacagtgtcgaattcttcctgaccctcgcggtctcggcgaccttcatctggcaccttggt
ctcgaagacatagcgggggcgaccctcggcctgctcattggcggtgtcctcgccgcgccc
ctcggcgcagtgatggcaaagcgcttctcgccaaagctcatgctgattctcgtcggcttt
gtgctcactgcgacgagcgcctttggtctatacaaggtgctcgcctag

DBGET integrated database retrieval system