KEGG   Sphingopyxis sp. 113P3: LH20_01340Help
Entry
LH20_01340        CDS       T04069                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sphp  Sphingopyxis sp. 113P3
Pathway
sphp00473  D-Alanine metabolism
sphp01100  Metabolic pathways
sphp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sphp00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LH20_01340
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    LH20_01340
Enzymes [BR:sphp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     LH20_01340
Peptidoglycan biosynthesis and degradation proteins [BR:sphp01011]
 Precursor biosynthesis
  Racemase
   LH20_01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALC10587
UniProt: A0A0M4D686
LinkDB All DBs
Position
316262..317407
Genome map
AA seq 381 aa AA seqDB search
MQQLSCVESCSSRLGIDLDALRANYRTLTERVAPARCGAVVKANAYGLGATRVGAALYRE
GCRTFFVAQLSEVAPLASAVGADAAIFILNGLDPASEGACTAAGAIPVLNSLSQVTRWRA
SARRLGFPLPAALQVDSGMSRLGLAVEDALALAADPACARELDLRLLMTHLACADEPGRA
ANGEQLAAFRRIAAHFPGVPASIANSGGVFLPPPFHADLARPGVALFGVDPGPHAVGLRP
VVQLHARVLQIRTVAAGTRVGYGLDHIAPAPQRLATIALGYADGWPRSLGGAGALWHRGI
RLPIVGRVSMDSLTVDISALPQGELAEGDFVECLGPSQSLADAARDARTIAYEILTRLGA
RHARIFVEDGNAEIVLPGRAP
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagttatcttgcgttgaaagctgttcgagccgccttggcatcgacctcgatgcc
ctgcgcgccaattaccgcacgctcaccgaacgcgtagcgcccgcgcgctgcggtgcggtg
gtcaaggcgaatgcctatggtctcggcgcaacgcgcgtcggcgctgcgctgtatcgcgaa
ggctgccgcacctttttcgtcgcccagctctcggaggtcgccccgcttgcaagcgcggtc
ggcgctgacgctgcgattttcattctcaatgggctcgaccctgcgagcgagggagcctgc
actgctgctggcgctatccctgtgctcaattccttgtcgcaagtcacgcgctggcgcgcc
agcgcccgcaggctcggatttccgcttcccgctgcgctacaggtcgacagcggcatgtcg
cgcctcggcctcgcggtggaggatgcgctcgcgctcgccgccgaccccgcgtgcgcccgc
gaactcgacctccggctgctgatgacgcatcttgcctgcgccgacgagccaggccgcgct
gcgaatggggagcagcttgctgcctttcgccggattgcagcgcatttcccgggtgtcccc
gcgtcgatcgccaacagcggcggcgtctttctccccccaccattccacgcggatctcgcg
cgtccgggcgtcgcattgttcggggtcgatccggggccccacgcggtagggctgcgcccc
gtcgtccagcttcacgcccgggtgctccagatccgcaccgtcgcggcgggaacccgggtc
ggctatggcctggaccatatcgcccccgcgccgcagcggcttgcaacgatcgcgctgggc
tatgccgacggctggccgcgctccctcggcggcgcgggggccttgtggcaccgcggcata
cggctgcccatcgtcgggcgcgtttccatggacagcctcaccgtcgacatcagcgccctt
ccccagggcgaactcgccgaaggcgatttcgtcgaatgtcttgggccctcgcagtcgctc
gcagatgcggcgcgcgacgctcgaaccatcgcctatgagatactgacgcggctcggtgca
cgtcacgcgcgcatcttcgtcgaggacggcaacgccgagatcgtcctgccggggcgcgcg
ccatga

DBGET integrated database retrieval system