KEGG   Sphingopyxis sp. 113P3: LH20_02425Help
Entry
LH20_02425        CDS       T04069                                 

Definition
(GenBank) hypothetical protein
  KO
K07283  putative salt-induced outer membrane protein
Organism
sphp  Sphingopyxis sp. 113P3
Brite
KEGG Orthology (KO) [BR:sphp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    LH20_02425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF481 TetR_C_28
Motif
Other DBs
NCBI-ProteinID: ALC10800
UniProt: A0A0M4D6M2
LinkDB All DBs
Position
531650..532807
Genome map
AA seq 385 aa AA seqDB search
MRQAARLTAAIFLIAAGVRPAWSAVPDPALPAAIAPMVVASMEARPLPLPDPVRAMIEAA
IASGERKDVETVIALAKATNPRSLTDIDAILAAWKAQGQGKPEPDPIRQMLAAAMASKKD
GDVEAVGALAKKTSPDRVADIDALLIDYRSKRAAEKKAAAEAARAKLAASKFWENWKGEG
QIGASHSSGNTDSVGLSLGVALNRKGINWSHRLRAQADYQRTNGRTTVEKFLTEYEPQAR
IGDHAFAYGLGRWERDRTAGYHARWNLSGGLGYKVIAKKDLTLNLKAGPAWRQIDLVYGN
TESELTGLAALDLGWKLSPTLSLSQVASTIIGERTTTTSSLTALNAKLTGALSARVSYSA
ELDTNPPAGVENLDTLTRFTLVYGF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagacaagctgcgcgcctcacggccgccattttcctgattgccgccggcgtgcgcccg
gcatggtcggcggtgcccgatcccgcgcttcccgcggcgatcgccccgatggttgtcgca
agcatggaagcgcgccccttgccgcttcccgaccctgtacgcgcgatgatcgaggctgcg
atcgcgagcggcgagcgcaaggacgtcgaaaccgtgattgcgctcgcgaaggcgacgaat
ccgcgctcgctgaccgatatcgacgcgattctcgccgcctggaaggcgcagggccagggc
aaacccgagcccgacccgatccgccagatgcttgcggcggcgatggcgagcaagaaggac
ggcgacgtcgaggcggttggcgcgctggcaaaaaagaccagccctgaccgggtggccgac
atcgatgccttgctgatcgactatcgttcgaagcgcgctgccgagaagaaggcggccgcc
gaggcggcgcgcgcgaaactcgcggcctcgaaattctgggagaactggaagggcgaggga
cagatcggcgcatcgcacagtagcggcaacacggattcggttgggctgagccttggcgtc
gcgctcaaccggaaggggatcaactggagccaccgtctgcgtgcgcaggccgattaccag
cggacgaacggccgcacgacggtcgagaaattcctgaccgaatatgagccgcaagcccgt
atcggcgaccacgccttcgcctacgggctcgggcgctgggaacgtgaccggaccgcgggc
tatcacgcgcgctggaacctgtcgggagggcttggctacaaggtcatcgcgaagaaggac
ctcactctcaatctgaaggccgggcctgcctggcgccagatcgacctcgtctatggaaac
accgaaagtgagctcacggggcttgccgcgctcgatctcgggtggaaactgtcgcctacg
ctcagcctgtcgcaggttgcctcgacgatcatcggcgaacggactaccacgacaagttcg
ctcactgcgctcaacgccaagctgaccggcgccctgtcggcgcgcgtgtcctattcggcc
gagctcgacaccaacccgcccgccggggtcgagaacctcgacacgctgacccgcttcacg
ctggtttacggcttttag

DBGET integrated database retrieval system