KEGG   Sphingopyxis sp. 113P3: LH20_04305Help
Entry
LH20_04305        CDS       T04069                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sphp  Sphingopyxis sp. 113P3
Brite
KEGG Orthology (KO) [BR:sphp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LH20_04305
Enzymes [BR:sphp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LH20_04305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_8 K_oxygenase NAD_binding_7 Thi4 Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: ALC11169
UniProt: A0A0M3QCL4
LinkDB All DBs
Position
899515..901098
Genome map
AA seq 527 aa AA seqDB search
MLDANLKQQLQGLLTNLREPIELVSSLDDGVKSAELADLLDEIAALSDKVSVERADDDAR
RPSFLIRRVGHPEIAVRFAGIPLGHEFTSLVLALLQVGGHPPKVAPEVIDQVRALEGDYH
FETYFSLSCQNCPDIVQALNLMSVVNPRITHTAIDGGLFQSEVERRQVMAVPTIFLNGEN
FGQGRMELEQILAKLDTGAEAKAAEKIAAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGI
AAERFGGQVLDTMAIENFISVPHTEGPRLVAQLEQHVKDYDVDVMNLQRAEKLIPAEREG
GLHEVRLANGASLKARTVILSTGARWRQLGVPGEEEYRNKGVAYCPHCDGPLYKGKRVAV
IGGGNSGVEAAIDLAGIVAHVTLIEFDSELRADAVLQRKLASLSNVKIITSAMTTEVLGD
GTKVTGLSYKDRGKGELHQVELEGIFVQIGLVPNTEWLKDSVALSQRGEIEVDHRGATSQ
PGIFAAGDCTTVPYKQIVIAMGEGSKAALSAFDYMIRLPAEAAVEAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctgaagcagcagcttcaaggcctcctcacgaatcttcgtgaaccg
attgaacttgtctcgtcgctcgacgatggcgtgaagtcggctgagctggcggatcttctc
gacgaaatcgccgcgctctccgacaaggtcagcgtggagcgcgccgacgacgatgcgcgc
cgcccgagcttcctcatacgccgcgtcggccaccccgaaatcgcggtacgcttcgcgggc
attccgctcggccacgaatttacctcgctcgtgctggcgctgctgcaggtcgggggccat
ccgcccaaggtcgcgcccgaggtgatcgaccaggttcgcgcgcttgagggcgactatcat
ttcgagacctatttttcgctctcgtgccagaattgccccgacatcgtgcaggccttgaac
ctgatgagcgtcgtcaatccgcgcataacgcacacggcaatcgacggcggcctcttccag
agcgaggtcgagagacgccaggtgatggccgtgccgacaatcttcctcaatggggagaat
ttcggccagggccggatggagcttgaacagatccttgccaagcttgacacgggcgctgaa
gcgaaggcggccgagaagatcgcggccaaggatgcgttcgacgttctcgttgtcggcggc
gggcccgcgggcgccgcggccgccatctatgcggcgcgcaaggggatccgcaccggcatc
gctgcggaacgtttcggcgggcaggtgctcgacacgatggcgatcgaaaatttcatctcg
gttccgcacaccgagggacccaggctcgtcgcgcagctcgagcagcatgtcaaagactat
gacgtcgacgtcatgaacctgcagcgcgccgaaaagctgatccccgccgagcgtgaaggc
ggtctgcacgaagtgcgccttgcaaacggcgcgtcgctgaaggctcggaccgtgatcctt
tcgaccggcgcccgctggcgtcagctcggcgtgccgggcgaagaagaatatcgcaacaag
ggcgttgcctattgtccgcactgtgatggcccgctctacaagggcaagcgcgtcgcggtg
atcggcggcggcaacagcggcgtcgaggcggcgatcgaccttgccggcatcgtcgcgcat
gtaacgctcatcgaatttgacagcgagcttcgcgccgacgcggtgttgcaacgcaagctt
gcgagcctctccaacgtcaagatcatcacctcggcgatgacgaccgaagtgctcggcgac
ggcacgaaggtaacgggcctgtcgtacaaggaccgcggcaagggcgaactccatcaggtc
gagcttgaaggcatcttcgtccagatcgggcttgtccccaataccgaatggctcaaggac
agcgttgccttgtcccagcgcggcgagatcgaggtcgaccatcgcggcgcaacaagccag
cctggaatcttcgccgcgggcgactgtacgaccgtgccctacaagcagattgtcatcgca
atgggcgaagggtcgaaggcggcgctgtcggcgttcgactatatgatccgcctgcccgcc
gaagctgcggtcgaggccgcctga

DBGET integrated database retrieval system