KEGG   Sphingopyxis sp. 113P3: LH20_07635Help
Entry
LH20_07635        CDS       T04069                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
sphp  Sphingopyxis sp. 113P3
Brite
KEGG Orthology (KO) [BR:sphp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LH20_07635
Enzymes [BR:sphp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     LH20_07635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3 Plant_NMP1
Motif
Other DBs
NCBI-ProteinID: ALC11821
UniProt: A0A0M4CTL8
LinkDB All DBs
Position
complement(1564095..1564784)
Genome map
AA seq 229 aa AA seqDB search
MTHPIFERWPAQHPDRLQLFSAPTPNGVKVGIMLEETGIAYEPHRIDIMANESHDPAFLA
LNPNGKIPAIYDPTGPNGTPLALFESGAILIYLADKTGQFLASDPNARYETIQWLMWQMG
GVGPMFGQLGFFHKFAGKDYEDKRPRDRYAAESARLLGVLDARLAERSWVMGDDYSIADI
SLLGWVRNLIGFYEAGDIVGFDRFVHVQRWLGAGLARPAVQRGLEVTAA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatcccatattcgagcgctggccagcgcagcatcccgatcgcctccagctcttc
tcggcgccaacccccaacggggtgaaggtcggcatcatgctcgaggaaacgggcattgcc
tacgagccgcaccggatcgatatcatggcaaacgaaagccacgatcccgctttcctcgcg
ctcaatcccaatggcaagattcccgcgatctacgaccccaccgggccgaacggcacaccg
ctggcgctgttcgaatcgggcgcgatccttatttatcttgccgacaagacagggcagttc
ctcgcctccgatccgaacgcgcgttacgaaacgatccagtggctgatgtggcagatgggc
ggcgtcggaccgatgttcgggcagcttggctttttccacaaatttgccggcaaggattat
gaagacaagcgcccgcgtgaccgctacgcggccgaatccgcgcgcctgctcggggtcctc
gacgcgcggctcgctgagcgctcctgggttatgggcgatgattacagcattgccgacatc
tcgctgctcggctgggtgcgcaatctgatcggcttttatgaagcgggcgacattgtcggg
ttcgaccgtttcgttcacgtccagcggtggctcggcgcgggcctggcgcggccagctgta
cagcgcggcctcgaagtgactgcggcttaa

DBGET integrated database retrieval system