KEGG   Sphingopyxis sp. 113P3: LH20_10775Help
Entry
LH20_10775        CDS       T04069                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
sphp  Sphingopyxis sp. 113P3
Pathway
sphp00250  Alanine, aspartate and glutamate metabolism
sphp00280  Valine, leucine and isoleucine degradation
sphp00410  beta-Alanine metabolism
sphp00640  Propanoate metabolism
sphp00650  Butanoate metabolism
sphp01100  Metabolic pathways
sphp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sphp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LH20_10775
   00650 Butanoate metabolism
    LH20_10775
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LH20_10775
   00280 Valine, leucine and isoleucine degradation
    LH20_10775
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LH20_10775
Enzymes [BR:sphp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LH20_10775
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     LH20_10775
Amino acid related enzymes [BR:sphp01007]
 Aminotransferase (transaminase)
  Class III
   LH20_10775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALC12435
UniProt: A0A0M4CYT5
LinkDB All DBs
Position
complement(2170047..2171324)
Genome map
AA seq 425 aa AA seqDB search
MARNIELLSRRNVAVPRGVATALPIFVSRAQNAELWDEEGQRYIDFAGGIAVLNVGHRHP
RVADAVRAQLDNYMHVAFQVTAYEPYVELAERLNALAPFSGEARTLLLTTGAEAVENAVK
IARAATGRPGVIAFTGAFHGRTALTMALTGKVAPYKRAFGAPVPHVYHLPFPVPHHGIEV
EDTLRALHYLFAADLPPEDVAAIIIEPVQGEGGFHAAPRELLAELRKLCDEHGIMLIADE
VQTGFGRTGRLFGIEHSGVEPDLVTVAKSMGGGLPISGVIGRAEVMDAVEPGGLGGTYGG
FPLGCAAGLAVLDIIEDEGLLGRADAIGKRITGRLHELAQRSDLLPIGHIRGLGAMIAFD
ILESRGADTVAINGAKAVTMRAAEEGLILLSCGPSGETIRILVPLTASDAIVDEGLAAIE
RALRA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtaacatcgaactgctcagccgccgcaacgtcgcggtccctcgcggcgtcgca
accgcgctccccatcttcgtttcgcgcgcgcaaaatgccgaactgtgggatgaagaggga
cagcgctacatcgattttgcaggcgggatcgcggttctcaatgtcggtcatcgccacccc
cgcgtggcggacgcggtgcgtgcgcagctcgacaattacatgcacgttgctttccaggtc
accgcctatgaaccctatgtcgaactcgccgagcgtttgaacgcactcgcccccttctcg
ggcgaggctcggaccttgctgctaacgacaggcgccgaggccgtggaaaatgccgtcaag
atcgcgcgcgctgcgacgggccgccccggtgtgattgctttcaccggcgccttccacggc
cggacggcgctgacgatggcgctgacgggcaaggtcgccccctacaagcgtgccttcgga
gcccctgtaccccatgtctatcacctccccttccccgttccccatcacgggatcgaggtc
gaggacacgctgcgcgcgctccattatctttttgccgccgacttgccgcctgaggatgtg
gcagcgatcatcatcgagcccgtacagggcgagggcggcttccacgctgctccgagggaa
ttgctcgccgagctgcgcaagctttgcgacgagcatggcatcatgctgatcgcagatgaa
gtgcagaccggcttcggccgcacgggccgcctgttcggcatcgagcatagcggggtcgag
cccgacctcgtcacagtcgcaaagtcgatgggcggcggattgccgatctcgggcgtgatc
ggccgcgccgaagtgatggacgcggtcgagccgggcgggcttggcggaacctacggggga
ttcccgctcggatgtgccgcgggccttgcggttctcgacatcatcgaggacgaggggctt
ctcggacgcgccgacgcgatcggcaagcggattacgggccgtcttcatgagctcgcccag
cgcagcgaccttctcccgatcggtcacatccgcgggctcggcgcgatgatcgcatttgac
atcctcgaaagccgcggcgccgataccgtcgcgatcaatggcgcaaaggccgtcacgatg
cgcgccgccgaggaaggccttattctcctgagctgcggcccctcgggcgagacgatccgt
attctcgtgccgctcaccgcctccgacgcaatcgtggacgaaggtcttgccgcgatcgag
cgggcgctcagggcatga

DBGET integrated database retrieval system