KEGG   Sphingopyxis sp. 113P3: LH20_16505Help
Entry
LH20_16505        CDS       T04069                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sphp  Sphingopyxis sp. 113P3
Brite
KEGG Orthology (KO) [BR:sphp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sphp01002]
    LH20_16505
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sphp04147]
    LH20_16505
   04090 CD molecules [BR:sphp04090]
    LH20_16505
Enzymes [BR:sphp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     LH20_16505
Peptidases [BR:sphp01002]
 Metallo Peptidases
  Family M2
   LH20_16505
Exosome [BR:sphp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LH20_16505
CD molecules [BR:sphp04090]
 Proteins
  LH20_16505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ALC13561
UniProt: A0A0M5IM01
LinkDB All DBs
Position
complement(3357356..3359200)
Genome map
AA seq 614 aa AA seqDB search
MKAMISTLSLAISLAFAASPVMAQTAPAETAAAAAPTAADAEAFIAAAEKDLFDYTVEAS
QVNWVNYNFITEDTDAMAARINAIGTEKAVKYALEAARYRDVPGLSADTKRKLDILRNGI
VLPAPTTEGAAAELNRIATDLSSQYGKGKGTLDGKPIAGSDIEAEMGNLEHTPAQFAEMW
TSWHDNVGAPMKRDYAKMVGIANEGAKELGFSDVGAMWRSGYDMPPEEFARTTERLWEEV
KPLYLALHTYVRWKLNEKYGDAVQPKTGPIRADLLGNMWAQEWGNIYPLVAPAGSGDLGY
DIGDLLKAQGKTPLDMVKAGENFYSSLGFAPLPETFWKRSLFVKPADREVVCHASAWNID
NKDDVRIKMCTKVNSDDFVTIHHELGHNYYQRAYNKQPFLYLNGANDGFHEAIGDFVALS
ITPQYLVDIGLLDKAQVPGADKDIGLLLRQAMDKVAFLPFGLLVDRWRWGVFDGTIQPAD
YNKAWTDLRQQYQGIIPPGERPADAFDPGAKYHIPGNTPYSRYFLARILQFQFYEAACKQ
AGWKGPLHRCSFYGNKKVGAKLNAMLEMGASKPWPDALEAFTGSREMSGKAMAAYFAPLK
TWLDEQNKGKPSGW
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatgatttcgaccctgtcgcttgcgatatcgctcgcctttgccgcgagcccg
gtgatggcccagaccgcccccgccgagacggcagccgcggctgctcccacggccgccgac
gccgaggccttcatcgccgcggccgaaaaggacctgttcgactatacggtcgaggcgagc
caggtgaactgggtcaattataatttcatcaccgaagacaccgatgcaatggctgcgcgg
atcaacgccatcgggaccgagaaggcggtgaaatatgcgctcgaagccgccaggtaccgg
gatgtgccggggctgagcgcggatacgaagcgcaagctcgacatattgcgcaatggcatc
gtgctgccagctcccacgacggaaggggccgcggctgaactgaatcggatcgccaccgat
ctttcgtcgcaatatggcaagggcaagggcacgctcgacggcaagccgatcgcgggctcc
gacatcgaggccgagatgggcaatctcgagcacacacccgcccagttcgcggagatgtgg
acgagctggcatgacaatgtcggtgcgccgatgaagcgcgattacgccaagatggtcggc
atcgccaacgagggcgccaaggaactgggcttcagcgacgtcggcgcgatgtggcgctcg
ggctatgacatgcctccggaggaatttgcgaggacgaccgagcggctctgggaggaagtg
aagccgctctacctggcgctccacacctatgtccgctggaaactgaacgagaaatatggc
gacgcggtacagcccaagacgggcccgatccgcgctgacctgctcggcaacatgtgggcg
caggaatggggcaatatttatccgctcgttgcgcctgcgggctccggggaccttggctat
gacatcggcgatctgctgaaagcccagggcaagacgccgctcgacatggtgaaggccggc
gagaatttttattcctcgctcggtttcgcgccgctgcccgagaccttctggaagcgcagc
cttttcgtcaagcccgccgaccgcgaggtcgtgtgccacgcctcggcctggaacatcgac
aacaaggacgacgtccgcatcaagatgtgcaccaaggtgaattcggacgatttcgtcaca
atccaccacgagcttggacacaattattaccagcgcgcgtacaacaagcagccgttcctc
tatttgaacggcgccaatgatggcttccacgaggcgatcggagatttcgtcgcgctgtcg
atcaccccgcaatatctggtcgacatcggcctgctcgacaaggcgcaggtgccgggcgcc
gacaaggatattggccttttgctgcggcaggcgatggacaaggttgccttcctgcccttt
ggcttgctcgtcgaccgttggcgttggggcgtgttcgacgggacgatccagccggccgat
tacaacaaggcctggaccgacctgcgccagcagtaccagggcatcatcccgcccggcgag
cggccggccgacgccttcgacccgggcgccaaatatcatatccctggcaataccccttat
tcccgctattttctcgcgcgcatcctgcagttccaattttatgaggcggcatgcaagcaa
gcagggtggaaggggccgctccaccgctgctccttctacggcaacaagaaagtgggcgcg
aagctcaatgccatgctcgagatgggcgcgtcgaagccctggcccgacgcgctcgaggca
tttaccggaagccgcgagatgtcgggcaaggcgatggccgcctatttcgcaccgctcaag
acgtggctcgacgaacagaataagggcaagccgtccggctggtaa

DBGET integrated database retrieval system