KEGG   Sphingopyxis sp. 113P3: LH20_16970Help
Entry
LH20_16970        CDS       T04069                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
sphp  Sphingopyxis sp. 113P3
Brite
Enzymes [BR:sphp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     LH20_16970
Lipid biosynthesis proteins [BR:sphp01004]
 Acyl-CoA synthetase
  Unknown
   LH20_16970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ALC13654
UniProt: A0A0M4CS18
LinkDB All DBs
Position
3444655..3446406
Genome map
AA seq 583 aa AA seqDB search
MTEKNNVAADELVPTPTECAQPRRFSDFSTVGEALDYAAAGTRGLNFHDPRGKLVRAYSY
RELREDAKRAAYRLIAAGIKPGDRIALIAETGPEFAALFFGTIYAGAWPVPLPLPTSFGG
RESYVGQLTVQLSSCDPAMLFFPPEIAAMATEAAEAKGVTPVDWSEFENRAAPIADLPQQ
NPDATCYLQYSSGSTRFPHGVAVTHAALLNNLSAHAHGMKLQDSDRCVSWLPWYHDMGLV
GCFLSPVANQVSVDYLKTEDFARRPLAWLDLISRNQGTTLSYSPTFGYDICARRISSQTN
VAERFDLSRWRVAGNGADMIRPDVMQSFVDAFGEAGFKASAFLPSYGLAEATLAVSIMPP
GEGIVVELVEETELSGGTGDAGRPTRYRAIVNCGKAVKDMVIEVRDEAGNVLPDQTVGKI
WCTGPSLMTGYYRDPEATAACMSDGWLDTGDMGYLSDGYVYVVGRAKDMIIINGKNHWPQ
DIEWAVEQLPGFKSGDIAAFAITAPGGEETPAVLVQCRTSDEAERLALRETIRERVRAIT
GMNCLVELIPPRTLPRTSSGKLSRSKARAQYLAGEIQPFAIAA
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaaaaacaatgtcgccgcggacgaactcgtccctacgcccaccgaatgcgca
cagccgcgccgtttctcggacttttcgaccgtgggcgaagcacttgattacgctgccgcg
ggcacgcgcggactgaattttcatgatccgcgcggcaagctcgttcgcgcttacagctat
cgcgagctcagggaggatgcgaagcgcgccgcctatcggctcattgccgcgggcatcaag
ccgggcgaccgcatcgcgctgatcgcggaaaccggccccgaattcgctgcgctcttcttt
ggcacaatctacgcaggagcatggccggtcccgctgccgctgccgaccagctttggcggc
cgcgaatcctatgtcggccagctcaccgtgcagctttcaagctgcgacccggcgatgctc
ttcttcccgcccgagattgcggcgatggcgaccgaggcggccgaggcgaagggggtcacc
cccgtcgactggagcgagttcgagaaccgcgctgccccgatcgcggatctgccgcagcag
aatcccgatgcaacctgctatcttcagtacagcagcggctcgacgcgctttccgcacggc
gttgcagtcacccatgccgcgctcctcaacaatctgtcggcgcacgcgcacggcatgaag
ttgcaggacagcgaccgatgcgtgtcatggctcccctggtatcatgatatgggcctcgtc
ggctgcttcctgtcgccggtcgccaatcaggtgtcggtcgactatctcaagaccgaagac
ttcgcgcggcggccgctcgcctggctcgatctgatcagccggaaccagggcacgaccctc
agctattcgccgaccttcggctatgacatctgcgcgcggcgcatttccagccagaccaat
gtcgccgagcgtttcgacctttcgcgctggcgcgtcgccggcaatggcgccgacatgatc
cgccccgacgtgatgcagagcttcgtcgacgcctttggcgaagcgggcttcaaggcgagt
gccttcctcccgagctatggcctcgccgaggcaacactcgcggtcagcatcatgccgccg
ggtgaaggcattgtggtggaactggtcgaggagaccgagctttcgggcggcaccggcgac
gccgggcggccgacccgctaccgcgcgatcgtcaactgcggcaaggccgtcaaggatatg
gtgatcgaggtacgcgacgaggccggaaacgttcttccggaccagacggtcggcaagatc
tggtgcacaggcccgtcgctgatgacgggctattaccgcgaccccgaggcgaccgccgcc
tgcatgtcggacggatggctcgacacaggcgacatgggctatctgtcggacggctatgtc
tatgtcgtgggccgcgccaaggacatgatcatcatcaacggcaagaatcactggccgcag
gatatcgagtgggcggtcgagcagcttcccggcttcaagtcgggtgacattgccgccttc
gcgattaccgcgccgggaggcgaggagacccccgcggtactcgtccagtgccgcaccagc
gacgaggccgagcgcctcgcgctgcgcgagacgattcgcgagcgcgtccgggcgatcacc
ggcatgaactgccttgtcgaactcatcccgccgcgcacgctgccgcgcacgagttcgggc
aagctcagccggtcgaaggcgcgggcgcaatatctggccggcgaaatccagcccttcgcg
atcgcggcgtag

DBGET integrated database retrieval system