KEGG   Sphingopyxis sp. 113P3: LH20_17555Help
Entry
LH20_17555        CDS       T04069                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sphp  Sphingopyxis sp. 113P3
Pathway
sphp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sphp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LH20_17555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sphp02000]
    LH20_17555
Enzymes [BR:sphp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LH20_17555
Transporters [BR:sphp02000]
 Other Transporters
  Pores ion channels [TC:1]
   LH20_17555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ALC13768
UniProt: A0A0M5IJR5
LinkDB All DBs
Position
3571153..3571788
Genome map
AA seq 211 aa AA seqDB search
MADNLIFYTNPMSRGQIVRWMLEEVGAPYETRLLDFGTTMKADDYLAINPMGKVPAVIHA
GKVVTECAAICAYLADAFPAAALAPSPADRADYYRWLFFTAGPVEQAITAKFFGIEPDAD
QQRSAGFGTLELALGALERAVAGKTYVAGERFTAADVYVGSQIDWGMEFGTIPARPAFEA
YVAPLRERAAYKRAKEIDNGLIAEMQAANPA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaatctcatattctacaccaaccccatgtcgcgcgggcagatcgtgcgctgg
atgctcgaagaggtgggcgccccctacgaaacgcgcttgcttgattttggtacgacgatg
aaagcggacgattatctggccatcaatccgatgggtaaggtgcccgcggtcatccatgcg
ggcaaggtggtaaccgaatgcgccgcgatctgcgcctatctcgccgacgccttccctgcc
gcggccctcgccccctcccccgccgatcgggccgattattatcgctggctctttttcacc
gccggccccgtcgagcaggcgatcaccgccaagtttttcgggatcgagcccgacgccgac
cagcaacgctctgcggggttcgggacgctcgagctcgcgctcggcgcgctcgagcgcgcg
gttgcgggcaagacctatgtcgccggcgagcgcttcaccgccgccgacgtctatgtcggg
agccagatcgactggggtatggagttcggcaccatccctgcgcgtcccgcattcgaggcc
tatgtcgcaccgctgcgcgagcgcgcggcttacaagcgggccaaagagatcgacaacggc
ctcattgccgagatgcaggcggcgaaccccgcgtag

DBGET integrated database retrieval system