KEGG   Sphingopyxis sp. 113P3: LH20_18610Help
Entry
LH20_18610        CDS       T04069                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sphp  Sphingopyxis sp. 113P3
Pathway
sphp00680  Methane metabolism
sphp01100  Metabolic pathways
sphp01120  Microbial metabolism in diverse environments
sphp01200  Carbon metabolism
Module
sphp_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sphp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LH20_18610
  09102 Energy metabolism
   00680 Methane metabolism
    LH20_18610
Enzymes [BR:sphp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LH20_18610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALC13974
UniProt: A0A0M5IUQ1
LinkDB All DBs
Position
3770159..3772837
Genome map
AA seq 892 aa AA seqDB search
MGPPIQISQNPDIRYLGRILGDVIRAYGGDKLFRQTEYIRSASVDRHRGIAGAEAIDPGL
EALSLDDTIAFVRGFMLFSMLANLAEDRQGVAIEPEATMAAALAKLAADGVDTAAVAALL
DAALIAPVLTAHPTEVRRKSMLDHKNRIAELMRLRDAGAEETSEGDVVEDAIRRQIVLLW
QTRPLRTEKLFVADEIDNALTYLRDVFLPVVPKLYARWEKQLGRRPASFLRVGSWIGGDR
DGNPSVTAETLRMATTRNAAAVLSHYLDAVHALGAELSVSSALASVPPAVETLAEASGDA
ALSRRDEPYRRALSGIYARLSATHAEIVGKSPPRPSALAGEPYATPGDFRRDLVTIAGGL
SASGEGQLGGIGALGRLIRAVEVFGFHLATLDMRQNSAVHERVLAELLSVSGVCADYRAL
SEEERVALLTAELASDRPLAAPWHEWSEETAGELAIVHAAADVRRRLGTDTICQWIISMA
QDLSDLLEVHVLAREGGLWRSGAEAGATNLMVVPLFETIDDLSRAPDIMTRYFAMPELGP
QVRVRGYQEVMIGYSDSNKDGGYLTSTWGLHQASQALTPVFEKAGSAMQLFHGRGGAVGR
GGGSAFAAIRAQPAATVQGRIRITEQGEVIAAKYGSADSAATNLEAMVSASLLASLEADA
IREDDHPRYAAAMTALSDTAFAAYRGLVYETPGFKDFFRAMTPIAEIATLKIGSRPSSRT
KSSAIEDLRAIPWVFSWAQSRAMLPGWYGTGEAFAAFKDPVLLADMAQSWPFFAALLGNM
EMVLAKSDMGIAARYAALAGAVDGHEAIFTRIRDGWNRAHDGLLAITGQTRLLEKSPALE
ASIRLRLPYIEPLNLLQIELMKRHRAGETDPRIAEGIQLTINAIATALRNSG
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgggcccgccgatccagatctcgcaaaatcccgacatccgctatctcgggcggatattg
ggcgacgtcattcgcgcctatggcggcgataagctcttccggcagaccgaatatatccgc
tcggcgagtgtcgaccggcaccgcggtatcgccggagccgaggcgatcgacccggggctc
gaggcgctgagcctcgacgacacgatcgccttcgtgcgcggcttcatgctgttttccatg
cttgccaacctcgccgaggaccgtcagggcgtcgcgatcgagcccgaggcgacgatggca
gcggctctcgccaagctggctgccgacggcgtggacaccgccgcggtcgcagccctgctc
gatgcggcgctgatcgcaccggtgctgaccgcgcacccgaccgaggtgcgccgcaagtcg
atgctcgaccacaagaaccgtatcgccgaactgatgcggctgcgcgacgcgggtgcggag
gaaacatccgagggcgacgtggtcgaagatgcgatccgccggcagatcgtgctcctgtgg
cagacgcgcccgctgcggaccgaaaaattgttcgtcgccgacgagatcgacaatgcgctc
acctatttgcgcgatgttttcctccccgtcgtgcccaagctctacgctcgctgggaaaag
cagctgggccgccgtcctgcgagtttcctgcgcgttggtagctggatcgggggcgatcgc
gacggcaacccctccgtcaccgccgaaacgctgcgcatggcaaccacgcgcaatgccgcc
gccgtgctcagccattatctcgatgccgtgcacgcgctcggggccgaattgtcggtgtcc
tcggcgctcgcctccgtcccgccagcggtcgagacgctagccgaggcgagcggggacgcc
gcgctcagccgccgcgacgaaccttatcgccgcgcgctgtcgggcatctatgcgcggctt
tcggcaacccatgccgagatcgtcggcaagtctccgccgcgtccttcggcgctcgcgggc
gaaccctatgcgacgccgggcgatttccggcgcgatctcgtcaccatcgccggcggcctg
tcggcgagcggcgagggccagctcggcggcatcggcgcgctcgggcggctgatccgcgcg
gtcgaagtcttcggttttcaccttgcgaccctcgacatgcggcagaacagcgcggtgcat
gaacgcgtcctcgccgagctgttgagcgtgtcgggcgtgtgcgccgattacagggcgctc
agcgaggaggagcgcgtcgcattgctcacggcagaactcgcaagcgaccgcccgctcgca
gcgccctggcacgaatggagcgaggagaccgcgggcgagcttgcgatcgtccacgcggcg
gccgacgtacggcgccggctcgggacggacacgatctgccagtggatcatctcgatggcg
caggacctctccgaccttctcgaggtgcatgtactcgcgcgcgagggcgggctgtggcga
agcggtgctgaggcgggcgcaacgaacctgatggtagtgccgctgttcgagacgatcgac
gacctcagccgtgcccccgacatcatgacgcgctatttcgcgatgcccgagctcggcccg
caggttcgcgtgcgcggctaccaggaagtgatgatcggctattccgattcgaacaaggat
ggcggctatctgacgtctacctgggggcttcaccaggcatcgcaagcgctcactcccgtg
ttcgagaaggcgggaagcgcgatgcagctgttccacggccgcgggggcgcggtcggacgc
ggcggcggtagcgctttcgccgcgatccgcgcccagcctgcagcaaccgtgcaagggcgg
atccgcatcaccgaacagggcgaagtgatcgcagcgaaatatggcagcgccgacagcgcg
gcaaccaatctggaagcaatggtttcggcgagtctgctcgcgagcctcgaggccgacgcc
atccgcgaggacgatcacccgcgctacgccgcagcgatgaccgcgctctcggacacggcc
ttcgcggcctaccgcgggcttgtctacgagacgccgggattcaaggatttcttccgcgcg
atgaccccgatcgctgaaatcgcaacgctgaaaatcggctcgcgcccgtcgagccgcacg
aagagcagcgcgatcgaggatctgcgcgcgattccctgggtgttcagctgggcccagtcg
cgcgcgatgctgcctggctggtacgggacaggcgaagctttcgcggcgttcaaggatccg
gtcctgcttgccgacatggcgcaaagctggccctttttcgccgcgcttctcggcaatatg
gagatggtgctcgcgaaatcggacatggggatcgcagcgcgctatgccgcgctcgcgggc
gcagtcgacgggcatgaggcgatattcacccgcatccgtgatggctggaaccgggcccac
gacgggctgctcgcgatcaccggacagacgcggctcctcgagaagagcccggcgctcgag
gcctcgatccggctgcgactaccctatatcgagccgctcaatcttttgcagatcgagttg
atgaagcgtcaccgcgccggcgagaccgatccgcgcatcgccgaggggatacaactcacg
atcaacgcaatcgcgacggcgctgcgcaatagcggctga

DBGET integrated database retrieval system