KEGG   Sphingopyxis sp. QXT-31: BWQ93_04170Help
Entry
BWQ93_04170       CDS       T04913                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
sphq  Sphingopyxis sp. QXT-31
Pathway
sphq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sphq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BWQ93_04170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sphq02000]
    BWQ93_04170
Enzymes [BR:sphq01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     BWQ93_04170
Transporters [BR:sphq02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    BWQ93_04170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 RsgA_GTPase AAA_22 AAA_29 AAA_16 AAA_30 AAA_33 AAA_23 AAA_18 AAA_28 Rad17 AAA_24 RNA_helicase NACHT
Motif
Other DBs
NCBI-ProteinID: APZ97773
UniProt: A0A1P8WUN7
LinkDB All DBs
Position
complement(834857..835639)
Genome map
AA seq 260 aa AA seqDB search
MTQEDLTIADPKMTAHNVNVFYGEKQAINDVSIDVGTELVTAFIGPSGCGKSTFLRSLNR
MNDTVAGAKVTGKISLDGEDIYAPSMDVVQLRARVGMVFQKPNPFPKSIYDNVAYGPRIH
GLAPNKNDLDGIVEKALHRAGLWDEVKDRLQESGTALSGGQQQRLCIARAIAVDPEVILM
DEPCSALDPIATAKIEELIHELRGKFAIVIVTHNMQQAARVSQRTAFFHLGTLVEYGKTT
DIFTNPKQERTKDYITGRYG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagaagatctcactatcgccgaccccaagatgacggcgcacaacgtcaacgtc
ttctatggcgagaagcaggcgatcaacgatgtgtcgatcgacgtcggcaccgagctggtc
accgcctttatcggcccctcgggctgcggcaagtcgacctttctgcgctcgctgaaccgg
atgaacgacaccgtcgcgggcgcgaaggtgacgggcaagatttcgctcgacggcgaggac
atctatgcgccgtcgatggacgtggtgcagctgcgcgcacgcgtcggcatggtgttccag
aaaccgaacccgttccccaagtcgatctacgacaatgtcgcctatggtccgcgcatccac
ggcctggcgccgaacaagaacgacctcgacggcatcgtcgaaaaggcgctgcaccgcgcg
ggcctgtgggacgaggtcaaggaccggctgcaggaaagcggcaccgcgctgtcgggcggc
cagcagcagcggctgtgcatcgcccgggcgatcgcggtcgaccccgaagtcatcctgatg
gacgagccctgctcggcgctcgatccgatcgcgaccgcgaagatcgaggaactgatccac
gagctccgcggcaaattcgcgatcgtgatcgtcacccacaatatgcagcaggcggcccgc
gtgtcgcagcgcaccgctttcttccacctcgggactttggtcgagtacggcaagaccacc
gacatcttcaccaacccgaagcaggaacgcaccaaggattatatcaccggccgctacggt
taa

DBGET integrated database retrieval system