KEGG   Sphingopyxis sp. QXT-31: BWQ93_13185Help
Entry
BWQ93_13185       CDS       T04913                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sphq  Sphingopyxis sp. QXT-31
Brite
KEGG Orthology (KO) [BR:sphq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sphq01002]
    BWQ93_13185
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sphq04147]
    BWQ93_13185
   04090 CD Molecules [BR:sphq04090]
    BWQ93_13185
Enzymes [BR:sphq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     BWQ93_13185
Peptidases [BR:sphq01002]
 Metallo Peptidases
  Family M2
   BWQ93_13185
Exosome [BR:sphq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BWQ93_13185
CD molecules [BR:sphq04090]
 Proteins
  BWQ93_13185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: APZ99329
UniProt: A0A1P8WZ36
LinkDB All DBs
Position
complement(2748510..2750360)
Genome map
AA seq 616 aa AA seqDB search
MKAMISTMSLALSLALAGPALAAEKAKDKPAAGKSAQPTAADADAFIAAAEKDLFDYTVE
ASQVNWVNATYLTEDTDAMASRINAVGTEKAVKYALEAAKYASVPGLSDDTKRKLDILRN
GLVLPAPTKPGAATELNRIATDLQSQYGKGRGTLKGKEISGSDIEAEMGNLQHTPAEFAE
MWTSWHDNVGAPMKQDYAKLVGIANEGAKELGFANTGAMWRSGYDMPPEEFAKTTERLWQ
EVKPLYMALHTYVRSKLNEKYGDAVQPKTGPIRADLLGNMWAQEWGNIYPLVAPAGSGEL
GYDIGDLLTEKGKGPLDMVKAGENFYSSLGMEALPETFWKRSMFTKPADREVVCHASAWD
IDNKDDIRIKMCIKVNADDFVTIHHELGHNYYQRAYKEQPFLYLNGANDGFHEAIGDFVA
LSITPQYLVDIGLLDEAKVPSADKDTGLLLRQAMDKVAFLPFGLLVDRWRWGVFDGTIKP
ADYNKAWTQLRTQYQGIVPPGQRPAEAFDAGAKFHIPGNTPYTRYFLARILQFQFYKAAC
DQAGWKGPLHRCSFYGNKEVGAKLNAMLEMGASKPWPDALEAFTGSREMSGKAMAEYFAP
LKAWLDEQNKGKPTGW
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatgatctcgacgatgtcgctcgccttgtcgctcgcgctcgccggccccgcg
ctggcggccgaaaaggcgaaggacaagcccgcggccggcaagtcggcgcaacccaccgcg
gcggacgccgacgcctttatcgccgccgccgaaaaggatctgttcgactatacggtcgag
gcgagtcaggtgaactgggtcaacgcgacctacctcaccgaggacaccgacgcgatggcc
tcgcggatcaacgccgtcggcaccgaaaaggcggtcaaatatgcgctcgaggccgcgaaa
tatgcgagcgtgccggggctcagcgacgataccaagcgcaagctcgacatcttgcgcaac
ggcctcgtcctccccgcgccgaccaagccgggcgccgcgaccgagctcaaccgcatcgcg
accgacctccagtcgcagtacggcaaggggcgcggcacgctgaagggcaaggaaatctcg
ggctcggatatcgaggccgagatgggcaatctccagcacactcccgccgaattcgccgaa
atgtggaccagctggcacgacaatgtcggcgcgccgatgaagcaggattacgccaagctg
gtcggcatcgccaatgagggcgcgaaggagctgggcttcgcgaacaccggcgcgatgtgg
cgctcgggttacgacatgccgccggaggaattcgccaagaccaccgagcggctttggcag
gaagtgaagccgctctacatggcgctccacacctatgtccgctcgaagctcaacgagaaa
tatggcgacgcggtgcagcccaagaccggtccgatccgtgccgacctgctcggcaatatg
tgggcgcaggaatggggcaatatctacccgctggtagcgcccgcgggttcgggcgaactc
ggctacgacatcggcgacctcctgaccgaaaagggcaagggcccgctcgacatggtcaag
gcgggcgagaatttctattcgtcgctcggcatggaagcgctgcccgagactttctggaag
cgcagcatgttcaccaagcccgccgaccgcgaggtcgtgtgccacgcctcggcgtgggat
atcgacaacaaggacgatatccgcatcaagatgtgcatcaaggtgaatgccgacgatttc
gtcaccatccaccacgaactcggccacaactactaccagcgcgcctataaggagcagccg
ttcctctacctcaacggtgccaacgacggcttccacgaggcgatcggcgatttcgtcgcg
ctgtcgatcacgccgcaatatctggtggacatcggcctgctcgacgaggccaaagtgccg
agcgccgacaaggacaccggcctcttgctgcgccaggcgatggacaaggtcgccttcctg
cccttcggcctgctcgtcgaccgctggcgctggggcgtgttcgacggcacgatcaagccc
gccgattacaacaaggcctggacccagctgcgcacccaatatcagggcatcgtcccgccg
ggccagcgcccggccgaggccttcgacgcgggggcgaagttccatatcccgggcaacacg
ccctacacgcgctatttcctcgcgcgcatcctgcagttccagttctacaaagccgcatgc
gaccaggcggggtggaagggaccgctccaccgctgctccttctacggcaacaaggaggtt
ggcgcgaaattgaacgcgatgctcgaaatgggcgcgtcgaagccctggcccgacgctttg
gaggccttcaccggcagccgcgagatgtcgggcaaggcgatggccgaatatttcgcgccg
ctgaaggcatggctcgacgagcagaacaagggcaagccgaccgggtggtga

DBGET integrated database retrieval system