KEGG   Sphingopyxis sp. QXT-31: BWQ93_16035Help
Entry
BWQ93_16035       CDS       T04913                                 

Definition
(GenBank) pyrimidine 5'-nucleotidase
  KO
K07025  putative hydrolase of the HAD superfamily
Organism
sphq  Sphingopyxis sp. QXT-31
Brite
KEGG Orthology (KO) [BR:sphq00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BWQ93_16035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AQA00939
UniProt: A0A1P8X3N9
LinkDB All DBs
Position
complement(3333395..3334072)
Genome map
AA seq 225 aa AA seqDB search
MPQRLTDIDTWIFDLDNTLYPPSAKLFDLIDARMGAFIMRLLDVDAAEARRVQKQYFHDH
GTTMAGLMRHHDVAPEDFLVDVHDIALDRIAPDARLRAGLERLPGRRLVFTNADADYAAR
VLEARGIADLFDGICDIRVTRYTPKPDPAAYAMMVDHLGIDPKRSLFVEDMARNLTPAKA
LGMTTVWLDNGSESGHRDHLPDQVDFHATDISDWLDNLPTPWGIS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgccccagcgcctgaccgatatcgatacctggatcttcgatctcgacaacacgctctat
ccgccgtcggcaaaattgttcgacctgatcgacgcgcgcatgggcgccttcatcatgcgg
ctgctcgatgtcgatgccgccgaggcgcggcgggtgcagaagcaatatttccacgaccat
ggcacgacgatggcggggctgatgcgccatcatgacgtcgcgcccgaggatttcctggtc
gacgtccacgatattgcgctcgaccgcatcgcgcccgatgcgcggctgcgcgccgggctc
gaacggctgcccggacggcggctggttttcaccaatgccgacgccgattatgcggcgcgc
gttctggaagcgcgcgggatcgccgacctgttcgacggcatctgcgacattcgcgttacg
cgctatacgccgaagcccgatccggccgcctatgccatgatggtcgaccacctcggcatt
gaccccaaacgcagcctgttcgtcgaggatatggcgcgcaacctgaccccggcaaaggcg
ctagggatgaccaccgtgtggctggacaatggcagcgaaagcggccatcgcgaccacctg
ccggaccaggtcgatttccatgcgaccgacatttcggactggctcgacaatctaccgacg
ccttgggggatttcatga

DBGET integrated database retrieval system