KEGG   Sphingopyxis sp. QXT-31: BWQ93_18985Help
Entry
BWQ93_18985       CDS       T04913                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sphq  Sphingopyxis sp. QXT-31
Brite
KEGG Orthology (KO) [BR:sphq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BWQ93_18985
Enzymes [BR:sphq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BWQ93_18985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 FAD_binding_2 HI0933_like AlaDh_PNT_C DAO FAD_binding_3 NAD_binding_7 Thi4 NAD_binding_8 K_oxygenase Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AQA00311
UniProt: A0A1P8X1W4
LinkDB All DBs
Position
3955977..3957560
Genome map
AA seq 527 aa AA seqDB search
MLDANLKQQLQGLLTNLREPIELVSSLGDDAKSAELATLLDDIAALSDLVGVTQADDDAR
RPSFLIRRASDAQVAVRFAGIPMGHEFTSLVLALLQVGGHPPKVAPEVLEQVAALDGDYH
FETYFSLSCQNCPDIVQALNLMSVVNPRITHTAIDGGLFQAEVEDRKIMAVPTIFLNGET
FGQGRMELEQIVARLDSGAEAKAAEKIAAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGI
AAERFGGQVLDTMGIENFISVQHTEGPKLVAQLESHVKDYDVDIMNLQRAEKLIPAKVEG
GLHEVKLASGASLKARTVILSTGARWRQLGVPGEDKYRNKGVAYCPHCDGPLYKGKRVAV
IGGGNSGVEAAIDLAGLVAHVTLIEYDSELRADAVLQRKLASLPNVKIVTSALTTEVLGD
GEKVTGLSYKDRNKDELHQIELEGVFVQIGLVPNTEWLKEAVALSRHGEIEVDHRGETSQ
AGIFAAGDCTTVPYKQIVIAMGEGSKAALSAFDYMIRLPAEVEAEAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctgaagcagcagcttcaaggcctcctcacgaatcttcgtgaaccg
atcgaactcgtctcgtcgctcggcgacgatgccaaatcggccgagctggcgaccctgctc
gacgacattgccgcgctctcggacctcgtcggcgtgacgcaggccgacgacgacgcgcgc
cgccccagcttcctgatccgccgcgccagcgacgcgcaggtcgccgtccgtttcgcgggc
atcccgatggggcatgaattcacctcgctcgtcctcgcgctgctccaggtcggcggccac
ccgccgaaggtcgcgcccgaggtgctggagcaggtcgccgcgctcgacggcgactatcat
ttcgaaacctatttttcgctgtcgtgccagaattgccccgacatcgtgcaggcgctcaac
ctgatgagcgtcgtcaatccgcgcatcacccacaccgcgatcgacggcgggctgttccag
gccgaggtcgaggatcgcaagatcatggccgtgccgacgatcttcctgaacggcgagacg
ttcggccagggccgcatggagctcgaacagatcgtcgccaggctcgacagcggcgccgaa
gccaaggcggccgagaagatcgccgccaaggacgcgttcgacgtgctcgtcgtcggcggc
ggtcctgcgggcgctgcggccgccatctatgccgcgcgcaagggcatccgcaccggcatc
gccgccgaacgcttcggcgggcaggtgctcgacacgatgggaatcgagaatttcatctcg
gtccagcacaccgaagggcccaagctcgtcgcgcagctcgagagccacgtcaaagactat
gacgtcgacatcatgaacctccagcgcgccgagaaactgatcccggcgaaggtcgaaggc
ggcctgcacgaagtcaagctcgcaagcggcgcgtcgctcaaggcacgcacggtgatcctc
tcgaccggcgcgcgctggcgccagctcggcgtgccgggcgaggacaagtatcgcaacaag
ggcgtggcctattgcccgcactgcgacggcccgctctacaagggcaagcgcgtcgcggtg
atcggcggcggcaacagcggcgtcgaggccgcgatcgacctcgcgggcctcgtcgcgcac
gttacgctgatcgaatatgacagcgaactgcgtgccgacgcggtgctccagcggaaactg
gcgagcctgcccaacgtcaagatcgtcacctcggcgctgaccaccgaagtgctcggcgac
ggcgaaaaggtgacgggcctgtcgtacaaggaccgcaacaaggacgaactgcaccagatc
gaactcgaaggcgtgttcgtgcagatcggcctcgtccccaacaccgaatggctgaaggaa
gcggtcgccttgtcgcgccacggcgagatcgaggtcgaccatcgcggcgagacgagccag
gcgggcatcttcgccgccggcgactgcacgacggtgccgtacaagcagatcgtcatcgcc
atgggcgaaggttcgaaagccgcgctgtcggcgttcgattacatgatccgcctgcccgcc
gaggtggaagccgaggcggcgtaa

DBGET integrated database retrieval system