KEGG   Sphingopyxis sp. QXT-31: BWQ93_20100Help
Entry
BWQ93_20100       CDS       T04913                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sphq  Sphingopyxis sp. QXT-31
Pathway
sphq00061  Fatty acid biosynthesis
sphq00780  Biotin metabolism
sphq01100  Metabolic pathways
sphq01130  Biosynthesis of antibiotics
sphq01212  Fatty acid metabolism
Module
sphq_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sphq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BWQ93_20100
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BWQ93_20100
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BWQ93_20100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sphq01004]
    BWQ93_20100
Enzymes [BR:sphq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BWQ93_20100
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BWQ93_20100
Lipid biosynthesis proteins [BR:sphq01004]
 Fatty acid synthase
  Component type
   BWQ93_20100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AQA00505
UniProt: A0A1P8X2P8
LinkDB All DBs
Position
4208176..4209003
Genome map
AA seq 275 aa AA seqDB search
MTGLMTGKRGLIMGLANDKSLAWGIAKALHGAGAELAISYQGEVMLKRVKPLADQLGCDF
LIDCDVSDMANLDAAFATLGARWPTIDFVVHAIGYTNKEALRGHYADVTLDDFLMTMNIS
VYSFTAVAQRASQMMTPYDPETGKGGGSLLTLSYYGAEKVIPHYNVMGVAKSALETSVKY
LANDYGPQGVRVNAISAGPIKTLAASGIGDFRLILKWNEYNAPLRRNVTIDDVGGSALYL
LSDLASGVTGETHHVDAGYHTIGMKQEDAPDIALA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtctgatgacgggcaaacgcgggttgattatggggctggcgaacgacaagtcg
ctcgcctggggcatcgccaaggcgctgcacggcgcgggagccgagctggcgatttcgtac
cagggtgaggtgatgctgaagcgggtgaagccgctcgccgatcagctcggctgcgatttc
ctgatcgactgcgacgtgtccgacatggcgaacctcgacgccgccttcgcgacgctcggc
gcgcgctggccgacgatcgacttcgtcgtgcacgcgatcggctacaccaataaggaggcg
ctgcgcggccattatgccgatgtgacgcttgacgactttttgatgacgatgaatatcagc
gtctacagcttcaccgcggtggcgcagcgcgcgtcgcagatgatgacgccctacgatcca
gagacgggcaagggcggcggctcgctgctgaccttgagctattatggcgccgagaaggtg
atcccgcattacaacgtcatgggcgtggccaagtcggcgctggagaccagcgtcaaatat
ctcgccaacgattacggcccgcagggggtgcgcgtgaacgcgatctcggccgggccgatc
aagacgctggcggcgtcgggcatcggcgatttccgcctgatcctgaaatggaacgaatat
aacgccccgctgcgccgcaatgtcacgatcgacgatgtcggcggttcggcgctgtacctg
ctgagcgatctcgcgagcggggtcaccggcgagacgcatcatgtcgatgccggctaccat
acgatcggcatgaaacaggaagacgcgccggacatcgcgctcgcgtga

DBGET integrated database retrieval system