KEGG   Sphingobium sp. RAC03: BSY17_2264Help
Entry
BSY17_2264        CDS       T04461                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sphr  Sphingobium sp. RAC03
Pathway
sphr00020  Citrate cycle (TCA cycle)
sphr00190  Oxidative phosphorylation
sphr00650  Butanoate metabolism
sphr01100  Metabolic pathways
sphr01110  Biosynthesis of secondary metabolites
sphr01120  Microbial metabolism in diverse environments
sphr01130  Biosynthesis of antibiotics
sphr01200  Carbon metabolism
Module
sphr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sphr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sphr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sphr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSY17_2264
   00650 Butanoate metabolism
    BSY17_2264
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSY17_2264
Enzymes [BR:sphr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BSY17_2264
    1.3.5.4  fumarate reductase (quinol)
     BSY17_2264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer2 CCER1
Motif
Other DBs
NCBI-ProteinID: AOF98435
UniProt: A0A1B3MZA4
LinkDB All DBs
Position
complement(2316020..2316808)
Genome map
AA seq 262 aa AA seqDB search
MAEFALPKNSKISGKGVTHPAPAGATNVRSFKVYRYDPDSGQNPRYDTFEVDLDQCGPMV
LDALIKIKNEYDTTLTFRRSCREGICGSCSMNMNGKNGLACTTAIDECSGKDVKITPLPH
MDVIKDLVPDFTHFYAQYNSIQPWLKTVSPPPSGKERLQSPADREKLDGLYECILCACCS
TSCPSYWWNSDKFLGPAILLQAYRWLADSRDEYTGDRLDELEDPFRLYRCHTIMNCANVC
PKGLSPAKAIAETKKMMVERQL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggccgaatttgcgttgcccaagaacagcaagatcagcggtaagggtgtgacccacccc
gcccccgcaggcgcaaccaatgtgcgcagcttcaaagtctatcgctatgatcccgactcc
gggcaaaacccgcgttacgacacgttcgaggtcgacctcgaccagtgcggaccgatggtt
ctggacgcgctgatcaagatcaagaatgaatatgacaccacgctgaccttccgccgctct
tgccgcgaaggcatttgcggttcctgttcgatgaacatgaacggcaagaacggcctcgct
tgcaccaccgcgatcgacgaatgttcgggcaaggacgtgaagatcacgccgctgccgcat
atggacgtgatcaaggatctggtgcccgatttcacgcatttctacgcccagtacaactcg
atccagccctggctcaagaccgtgtcgcccccgccatcgggcaaggagcgactccagtcg
cccgccgaccgcgaaaagcttgacggcctttatgagtgcatcctgtgcgcctgctgctcg
accagctgcccctcctattggtggaacagcgacaagttcctgggtccggcgatcctgctt
caggcctatcgctggctggccgacagccgcgacgaatataccggggaccgcctcgacgag
ctggaagatcccttccgcctctatcgctgccacaccatcatgaactgcgccaatgtctgc
cccaagggtctgtcgccggccaaggcgatcgccgagaccaagaagatgatggtcgaacgg
cagctttga

DBGET integrated database retrieval system