KEGG   Sphingobium sp. RAC03: BSY17_2299Help
Entry
BSY17_2299        CDS       T04461                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sphr  Sphingobium sp. RAC03
Pathway
sphr00473  D-Alanine metabolism
sphr00550  Peptidoglycan biosynthesis
sphr01100  Metabolic pathways
sphr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sphr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSY17_2299
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSY17_2299
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BSY17_2299
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sphr01011]
    BSY17_2299
Enzymes [BR:sphr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BSY17_2299
Peptidoglycan biosynthesis and degradation proteins [BR:sphr01011]
 Precursor biosynthesis
  Amino acid ligase
   BSY17_2299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST TrkA_N
Motif
Other DBs
NCBI-ProteinID: AOF98085
UniProt: A0A1B3MYA3
LinkDB All DBs
Position
2347860..2348810
Genome map
AA seq 316 aa AA seqDB search
MTRGPWHVAVLMGGWSAERPVSLMSGEGVAKALESRGHRVTRIDMDRDVAARLAEAKADV
VFNALHGVPGEDGTVQGMMDLMGLIYTHSGLATSVIAIDKQLTKQALVPHGIPMPGGKIV
ASESLFAGDPLPRPYVLKPVNEGSSVGVAIVTAEGNYGHPIGRDSVGPWQDFPELLAEPY
IRGRELTTAVLGNEALLVTELRPKSGFYDFDAKYTDGMTEHVCPADIPPDITEACKTIAL
RAHQLLGCQGASRADFRWDDEQGIEGLYLLEVNTQPGMTPLSLVPEQAAKLGIDYATLVE
TIVEQALSRAGGTEHG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtggtccgtggcatgtcgccgtcctgatgggtggctggtcggcggagcggccg
gtttccctcatgagtggggagggcgttgccaaggcgctcgaatcgcgggggcatagggtc
acgcggatcgacatggatcgtgatgtcgcggcgcgtctcgccgaggccaaggccgatgtc
gtgttcaacgcgctgcacggcgttccgggcgaggatggcacggtgcaggggatgatggac
ctgatgggcctgatctacacccattcgggcctggcgacgtcggtcatcgcgatcgacaag
cagctgaccaagcaggcgctggtgccgcatggcattcccatgcccggcggcaagatcgtg
gcgagcgagagcctgtttgcgggcgatccgttgccgcgtccctatgtgttgaagccggtc
aatgaaggcagttcggtcggcgtggcgatcgtcacggcggagggcaattatggccatccc
atcggtcgcgacagtgtcggcccgtggcaggatttccccgaattgctggccgaaccctat
attcgcgggcgcgaactgacgacggccgtgctgggcaatgaagcgctgctggtgacggaa
ttgcgccctaagagcggcttttacgatttcgatgccaaatataccgatggcatgaccgag
catgtctgccccgccgatattccgcccgacatcaccgaagcctgcaagacgatcgcgctg
cgtgcgcatcaattgctgggctgccagggagcgtcgcgcgccgatttccgctgggacgat
gaacaggggattgaggggctctatctgctggaggtcaacacccagccgggcatgacgccc
ttgagcctcgtgcctgaacaggcggcgaagctgggcattgactatgccacgttggtagag
actattgtcgagcaagcgctgtcgcgcgccggggggacggaacatggctga

DBGET integrated database retrieval system