KEGG   Sphingobium sp. RAC03: BSY17_2437Help
Entry
BSY17_2437        CDS       T04461                                 

Definition
(GenBank) AAA domain protein
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
sphr  Sphingobium sp. RAC03
Pathway
sphr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sphr01100  Metabolic pathways
sphr01110  Biosynthesis of secondary metabolites
sphr01130  Biosynthesis of antibiotics
sphr01230  Biosynthesis of amino acids
Module
sphr_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sphr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSY17_2437
Enzymes [BR:sphr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BSY17_2437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 CoaE AAA_22 AAA_17 AAA_5 dNK AAA_16 AAA Cytidylate_kin AAA_28 MMR_HSR1 TsaE
Motif
Other DBs
NCBI-ProteinID: AOF95845
UniProt: A0A1B3MRV7
LinkDB All DBs
Position
complement(2487159..2487752)
Genome map
AA seq 197 aa AA seqDB search
MRFASVTGGCIAPLGMQRNSKFPPSVDRRGPIVLVGMMGVGKSTVGRRLAARLGLAFVDA
DEEIEKAAGMSVSEIFARYDEAYFRDGERRVIARLMDGAPKVIATGGGAFMQEDTRALIL
EQATAIWLDADIDVLVDRVSRREGRPLLKDRDPRTVLTELTAVRNPIYALAPIHVKSVAA
PHEVTVERIMEQLTAWQ
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcgatttgcctctgtgacggggggctgtatagccccgctcggcatgcagcgaaacagc
aaattccccccatccgtcgaccggcgcggtcccatcgtcctggtggggatgatgggcgtg
ggcaaatcgacggtggggcggcggctggcggcccggctggggctggcgttcgtcgatgcc
gatgaggaaatcgaaaaggcggcgggcatgagcgtgagcgagattttcgcccgctatgac
gaagcctattttcgcgatggcgagcggcgggtgatcgcccggctgatggatggcgcgccc
aaggtgatcgcgaccggcgggggcgccttcatgcaggaggacacccgtgcgctgatcctg
gagcaggcgacggcgatctggctggatgcggatatcgatgtgctggtggaccgggtttcg
cggcgcgaggggcggccgttgctcaaggatcgcgatccgcgcacggtgctgaccgaactg
acggcggtgcgcaatcccatctatgcgctcgcccccatccacgtcaaaagcgtcgccgca
ccgcatgaagtgacggtcgaacgcatcatggagcaattgacggcatggcaatag

DBGET integrated database retrieval system