KEGG   Sphingobium sp. RAC03: BSY17_2748Help
Entry
BSY17_2748        CDS       T04461                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sphr  Sphingobium sp. RAC03
Brite
KEGG Orthology (KO) [BR:sphr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSY17_2748 (ahpF)
Enzymes [BR:sphr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BSY17_2748 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_3 FAD_oxidored FAD_binding_2 NAD_binding_7 Glutaredoxin AlaDh_PNT_C NAD_binding_8 K_oxygenase Thi4 DAO FMO-like
Motif
Other DBs
NCBI-ProteinID: AOF97527
UniProt: A0A1B3MWR9
LinkDB All DBs
Position
complement(2796014..2797594)
Genome map
AA seq 526 aa AA seqDB search
MLDANLKGQLKGYLANITQPIELVASLDEGAKSRELGELLGDIAELSDKVTVVTGTDKRV
PSFMIRRAGTDIGVRFAGLPMGHEFTSLVLALLQVGGHPSKAAQDLIQQIKDIDGDFAFE
TYVSLSCQNCPDVVQALNLMSVLNPRISHVAIDGALFKEEVDSRKVMAVPTVFLNGEPFA
SGRMELEQIVAKIDSGAATRAAEKIKAQEPFEVLIVGGGPAGAAAAIYTARKGIRTGVAA
ERFGGQVLDTMDIENFISVSRTEGPKLASAMEAHVKDYDVEIMNLQKAAKLIPARTEGGY
HEVVLENGASLKGRTLILSTGARWRQMGVPGEEEYRNKGVAYCPHCDGPLYKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLASLPNVKIITSALTSKVDGDGD
RVTGLSYKDRNSGTEHDVALEGIFVQIGLVPNTEWLKDAVALSPRGEIEIDARGETSVPG
VFAAGDCTTVPYKQIVIAMGAGSTAGLSAFDYLIRLPASEEAAQAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcaaatctcaaaggacagctgaaaggctatctggcgaacatcactcagccg
atcgagctggtggcttcgctggatgaaggcgcaaagtcgcgcgaactgggcgaattgctg
ggcgatatcgccgaactgtcggacaaggtgaccgtcgtcaccggcaccgacaagcgcgtc
cccagcttcatgatccgccgcgcaggcaccgatatcggcgtgcggttcgcgggcctgccg
atgggccatgaattcacctcgctcgtcctggcgctactgcaggtcggcggccacccgtcc
aaggctgcgcaggacttgatccagcagatcaaggatatcgacggcgacttcgccttcgaa
acctatgtctcgctctcctgccagaactgccccgacgtggtgcaggcgctcaacctcatg
agcgtcctcaacccccgcatcagccacgtcgccatcgacggcgcgctgttcaaggaggag
gtcgacagccgcaaggtcatggccgtccccaccgttttcctgaacggcgaacccttcgcc
agcggccggatggaactggaacagatcgtcgccaagatcgacagcggcgccgccacccgc
gccgccgaaaagatcaaggcccaggaacccttcgaagtcctcatcgtcggcggcggtccc
gctggcgcggcggcggccatctataccgcgcgcaagggcatccgcaccggcgtcgcggca
gaacgcttcggcggccaggtgctcgacacgatggatatcgaaaatttcatctccgtctcg
cgcaccgaagggccaaagctggcctccgccatggaagcgcacgtcaaggattatgacgtc
gaaatcatgaacctgcaaaaggcggcgaagctgatcccggcccgcaccgaaggcggctat
catgaggtcgtgctggaaaatggtgcctcgctgaagggccgcaccctcatcctctcaacc
ggcgcgcgctggcggcagatgggcgtgcccggcgaagaggaatatcgcaacaagggcgtc
gcctattgcccgcattgcgatggcccgctctacaagggcaagcgcgtcgcagtgatcggc
ggcggcaatagcggcgtcgaagccgcgatcgacctcgccggtatcgtcgcccatgtgacg
ctgatcgagtttgacagccagctccgcgccgacgcggtgctgcagcgcaagctcgccagc
ctgcccaacgtcaagatcatcacctcggcgctcacgtcgaaggtcgatggcgatggcgac
cgcgtcaccggcctgtcctacaaggaccgcaacagcggcaccgaacatgacgtcgcgctg
gaaggcatcttcgtccagatcggcctcgtccccaacaccgaatggttgaaggacgcagtc
gctttgtccccccgcggcgaaatcgaaatcgacgcccgcggcgaaaccagcgtgccgggt
gtgtttgcagccggcgattgcacgacggtcccctacaagcagatcgtcatcgccatgggc
gcaggctcaacggcaggcttgtcggcgttcgactatctgatccgtttgcccgcgagcgag
gaggcggcgcaagcggcgtga

DBGET integrated database retrieval system