KEGG   Sphingobium sp. RAC03: BSY17_3040Help
Entry
BSY17_3040        CDS       T04461                                 

Definition
(GenBank) glutamine amidotransferase of anthranilate synthase/aminodeoxychorismate synthase family protein
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
sphr  Sphingobium sp. RAC03
Pathway
sphr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sphr01100  Metabolic pathways
sphr01110  Biosynthesis of secondary metabolites
sphr01130  Biosynthesis of antibiotics
sphr01230  Biosynthesis of amino acids
sphr02024  Quorum sensing
Module
sphr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sphr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSY17_3040
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    BSY17_3040
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSY17_3040
Enzymes [BR:sphr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     BSY17_3040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AOF97263
UniProt: A0A1B3MVZ1
LinkDB All DBs
Position
3134933..3135523
Genome map
AA seq 196 aa AA seqDB search
MILVIDNYDSFTWNLVHYLMELGARVEVVRNDAISAGQALSSGAKAFLLSPGPCTPNEAG
VSLDLVAACADAGAPLLGVCLGHQAIGQHFGGKVVRGGLMHGKTSPVTHDGTGLFAGIPS
PFTATRYHSLIVEDIPAELVVNATSEDGSVMGFRHATLPIHSVQFHPESIATEHGHDMLA
NFMRIAGMKVKTRESA
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgtcatcgacaattatgacagcttcacctggaacctggtccattatctgatg
gaactgggcgcgcgggtcgaagtcgtccgcaacgacgccatttcggcgggccaggccctc
tccagcggcgccaaggccttcctgctctcgcccggcccctgtacgcccaacgaagcgggc
gtcagcctcgacctcgtcgccgcttgcgccgatgcgggcgcgcctttgcttggcgtgtgc
cttggccatcaggcgatcggccagcatttcggcggcaaggtcgtgcgtggtggtttgatg
cacggcaagacctcccccgtcacccatgacggcaccgggctttttgcgggcatcccctcg
cccttcaccgccacccgctaccactcgctgattgtcgaggatattcccgccgaactggtg
gtcaacgcgaccagcgaagatggctcggtcatgggcttccgccacgcgaccctgccgatc
cactcggtccagttccaccctgaaagcatcgcgaccgaacatggtcacgacatgctggcc
aatttcatgcggatcgccggcatgaaggtgaagacgcgcgaatccgcctga

DBGET integrated database retrieval system