KEGG   Sphingobium sp. RAC03: BSY17_3760Help
Entry
BSY17_3760        CDS       T04461                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sphr  Sphingobium sp. RAC03
Pathway
sphr00473  D-Alanine metabolism
sphr01100  Metabolic pathways
sphr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sphr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSY17_3760 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BSY17_3760 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sphr01011]
    BSY17_3760 (alr)
Enzymes [BR:sphr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BSY17_3760 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:sphr01011]
 Precursor biosynthesis
  Racemase
   BSY17_3760 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Indigoidine_A
Motif
Other DBs
NCBI-ProteinID: AOF95091
UniProt: A0A1B3MPT2
LinkDB All DBs
Position
pBSY17_1:679204..680322
Genome map
AA seq 372 aa AA seqDB search
MDLQLAGNLRIDLAALVANYRLIAAQVAPASVAGVVKANAYGLGAAEVSRALLDAGCRHF
FVAHLCEATALHPHLPTDATLYVLNGVQPGAEAACAAIGALPVLNSLEQIDGWAATARRQ
GHALPAVIQVDSGMSRLGLASAELATLRDQPDRLAGIDVRLVITHLACADHPDDSFNPHQ
RATFDAIARQFPGVPRSIDNSGGAMTSGVTHGDIVRAGIALYGGAPHGKPNPMHAVVALD
AYIIQLRTVEAGAGVGYGLTHRFDRPSRIATVSVGYADGWPRHLSNRGFAYIGGVRAPIV
GRVSMDSLALDVTDVPDYLLYPAAAVELIGPHQSIDDVATQADTISYEILTRLGPRYART
YLPTPAAAIQEQ
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggatttgcagttggcgggcaatttgcgcatcgaccttgccgcattggtcgccaactac
cggctgatcgcggcgcaggtcgcccccgccagcgtcgcgggcgtggtcaaggccaatgcc
tatggtctgggcgcagccgaggtatcacgcgcattgctcgatgcgggctgccgccacttc
ttcgtcgcccatctgtgcgaagccaccgctctgcatccgcatctgccgaccgacgcgacg
ctctatgtcctcaacggcgtgcaacccggcgcagaggcggcttgcgcggcgatcggcgcg
ctgcccgtcctcaattcgctcgaacagattgacggctgggcggcaacggcccgcagacag
ggccatgcgctcccggcggtgatccaggtcgacagcggcatgtcgcgcctcggcctcgca
tctgcagaactcgccaccctgcgcgatcagccggatcggctggcgggcatcgacgtgcga
ctggtcattacccatctcgcctgcgccgatcatcccgacgacagcttcaacccgcatcag
cgcgccactttcgatgcgatcgcccggcaattccccggcgtgccccggtcgatcgacaac
tcgggcggcgccatgacgtcgggcgtcactcatggcgacatcgtccgcgccggtatcgcg
ctttatggcggcgccccccatggcaagcccaacccgatgcacgccgtcgtcgcgctcgac
gcctatatcattcagctacgcaccgtcgaagccggggcaggggtcggctatggcctcacg
catcgcttcgaccgcccctcgcgcatcgcgaccgtctcggtcggctatgccgatggctgg
ccacggcatctgagcaaccggggctttgcctatatcggtggcgtgcgcgcgccgatcgtc
ggccgcgtctcgatggacagcctcgcgctcgatgtcaccgacgtccccgactatctcctc
tatcccgcagccgccgtcgaactgatcggcccgcatcagtcgattgatgatgtcgccacg
caggcggacacgatatcctacgagattttgacccggctcggcccccgctacgcgcgcacc
tatctgcccacgcccgccgccgccattcaggagcaataa

DBGET integrated database retrieval system