KEGG   Sphingobium sp. RAC03: BSY17_4064Help
Entry
BSY17_4064        CDS       T04461                                 

Definition
(GenBank) hypothetical protein
Organism
sphr  Sphingobium sp. RAC03
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1173
Motif
Other DBs
NCBI-ProteinID: AOF98561
UniProt: A0A1B3MZN5
LinkDB All DBs
Position
pBSY17_2:105256..106551
Genome map
AA seq 431 aa AA seqDB search
MWLIDRHGDGRSARRIPLPDPVRSALVRWYAGEGSRGDEEAGIMLVQQARIGGKWIACDC
RDDDTAPPILTPAFLSEAETYYLRRLTSSKRPEHQPDCPFFRDQVTNRITEIRTHQTPAD
PPTGYFEVLRPAPEKLAQRPEEDTSDDRTRHASVPRLARLLWRLLDVAGLNLCAPLSHDL
VDHSISDEFKALTAAAGKMEIAPGIELGRALWTHAKALHSNRVYAGLRELSRNWPRGHAP
QAFLTLFSPAFKGAQVIVAGCEPVVIANRVQSPSVRGNPIKGPYLVIVVAGEYPEAHGYA
PLRAYAQPIYSGRRFIPVDSEFERTVLRELLAARHYLDRDGIDIAIEKPVFDKLTPIGAC
RPDFLLEARSRSTGEIRQLIVEAMGVEDEDYKASKAVTHPRMAQIAPVVSITPAHLHEGH
VRAILTDALNA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtggttgatcgatcgccatggcgacgggcgcagtgcgcgccgaatccccctccccgac
cctgtcaggtcggctctggtccgatggtacgcaggcgagggctcccgaggggacgaggaa
gcgggcatcatgttggtccagcaagcccggattggcggtaagtggatcgcatgtgactgc
cgggacgacgacacggcgccacccatcctgaccccagcctttctctccgaggcggagacc
tattatttgcgccgcctcaccagctcaaagcgccccgaacaccaacccgattgcccgttc
ttccgggatcaggtgacgaaccgcatcaccgagatccgtactcatcagacaccggcggat
cctcccacaggctatttcgaggttttgcggcccgctcccgagaagctggcccagcgaccg
gaggaagacacaagcgacgatcggacccgacatgcttcggtgccccgccttgcgcggctg
ctatggcgacttctcgacgtggcgggcctcaacctttgcgcgccgttgtcgcatgatctg
gtcgaccattcgatcagcgacgagttcaaggcgctcaccgcggccgcgggtaagatggag
atcgcgcctggcatcgagctcggtcgagctctgtggacccacgccaaggcgcttcacagc
aaccgcgtttatgccggacttcgcgagctgtctcgaaactggccgcgaggccatgcaccc
caagcgttccttaccctcttctcgcccgcgttcaaaggagcgcaagttatcgttgcgggg
tgcgagcccgtcgtgatcgccaatcgggttcaatccccgtctgtgcggggaaatccgatc
aagggcccctatcttgtcatcgtcgtggccggcgaatatcccgaagcgcacggctacgcg
cctttgcgggcctatgcccagcccatctattcgggcaggcgcttcattcccgtcgattca
gagtttgagcggaccgttttgcgcgagttgctggcggcacggcactatttggatcgggat
gggatcgacatcgcgatcgagaagcccgtctttgacaagctgacgccgatcggcgcctgc
aggccggatttcctcctcgaggctcgctcacgctccacgggcgagatccggcaactcatc
gtggaagccatgggcgtcgaggatgaggactataaggcatccaaggccgtcacgcatcca
cgcatggcgcagatcgccccggtggtcagcatcacgccggcacatctccacgagggccat
gtccgcgccattctgacggacgcgctcaacgcttaa

DBGET integrated database retrieval system