KEGG   Sphingobium sp. RAC03: BSY17_925Help
Entry
BSY17_925         CDS       T04461                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
Organism
sphr  Sphingobium sp. RAC03
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AOF96828
UniProt: A0A1B3MUP5
LinkDB All DBs
Position
complement(944175..945644)
Genome map
AA seq 489 aa AA seqDB search
MIPHDIRIAHPDKLYIGGQWVESAGGKSIEIVSPNSEDVIARVADAVEADMDRAVAAARK
AFDEGPWPTLSPAERGALVRRMGEELQKREPELARAWTLQVGGLASFAPIMTGGATASFM
QIAGYADSFTFVERRPSFQVDTAIVAYEPTGVVAAIAPWNAPYGIMASKVAYALVAGCTV
IMKPSPETPLEAYIMAEAAQAAGIPAGVVNLVCGGRDASDHLVNNPGIDKVTFTGSTGAG
KRIGEVCASRIARCTLELGGKSAAIVRDDFPIDVAAAILGNTISIMSGQVCAMLSRAIVP
RKRHDELADAIKAVMQGIRIGHSEDMATQLGPLAMKRQLERVEDYVAIGKGSADLVTGGA
RPAHMDKGYFMEPTLFANVDNQSRIAQEEIFGPVLCLIPAEDEEDAIRIANESNYGLNGS
VLTNDVDAAYRIARRVRAGGFGQNGMKLEFGLPFGGFKQSGIGREGGVEGLAAYLESKTI
LLDGTPTAL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgataccccacgacatccgcatcgcgcaccccgacaagctctatattggcgggcaatgg
gtggagtccgcaggcggaaagtcgatcgagatcgtctcccccaatagtgaggatgtgatc
gcccgcgtggccgatgcggtcgaggcggatatggatcgtgcggttgctgcggcgcgcaag
gcgttcgatgaggggccatggccaacgctcagccctgccgagcgcggtgcgctggtgcgc
cgaatgggtgaggaattgcaaaagcgggagccggagctggcgcgcgcctggacgctgcag
gtgggcggcctggcaagcttcgcgccgatcatgactggcggcgcgaccgccagcttcatg
cagattgcgggctatgccgacagcttcacgttcgtcgagcggcgcccgtcctttcaggtg
gacaccgcgatcgtcgcctatgagcccacaggcgtcgtggcggcgatcgcaccgtggaat
gcgccctatggcatcatggcaagcaaagtcgcttatgcgctggtggcgggctgtacggtg
atcatgaagccgtcgccggagacgccgctggaagcctatatcatggccgaggcggcgcag
gctgctggcatcccggccggcgtggtgaatctggtttgtggcgggcgcgatgcgtctgat
catctggtcaataatcccggcatcgacaaggtgaccttcacaggctccaccggggcggga
aagcgcatcggcgaggtttgtgcgagccgtattgcgcgctgcacgctggaactggggggc
aaatccgccgcgatcgtgcgcgacgatttcccgatcgacgtcgcggccgccattttgggc
aataccatatcgatcatgagcggccaggtctgtgcgatgctgagccgcgcaatcgtcccc
aggaagcgccatgacgaactggccgacgcaatcaaggccgtgatgcagggcatccgcatc
ggccatagcgaggatatggcaacgcagcttgggccgctggccatgaagcgacagttggag
cgcgtcgaagactatgtcgcgatcggcaagggtagcgctgatcttgttacgggaggcgcc
cggcctgcgcatatggacaagggctatttcatggagccgaccttgttcgccaatgtcgat
aatcagagccgcattgcgcaagaagagattttcgggccggtgctgtgcctgatcccggcg
gaggatgaagaagatgcgatccgcatcgccaatgaaagcaattatggcctcaatggatcg
gtcctgaccaatgatgttgatgcggcctatcgcattgcccggcgtgttcgcgcaggcggc
tttggccagaatggcatgaagctggaattcggcctgccttttggcgggttcaagcaatcc
ggcattggccgagagggtggcgtcgaggggcttgcagcctatctggagagcaagacgatc
ttgctcgatggtacgccgacggctctataa

DBGET integrated database retrieval system