KEGG   Sphingosinicella sp. BN140058: ETR14_00425Help
Entry
ETR14_00425       CDS       T05826                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sphs  Sphingosinicella sp. BN140058
Pathway
sphs03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sphs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    ETR14_00425 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sphs03400]
    ETR14_00425 (ligD)
Enzymes [BR:sphs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ETR14_00425 (ligD)
DNA repair and recombination proteins [BR:sphs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ETR14_00425 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: QAY75164
LinkDB All DBs
Position
100511..103210
Genome map
AA seq 899 aa AA seqDB search
MAKPANPLETYNQKRDFAKTAEPKGTFDKLSWGEGHGFMVQKHDATRLHYDFRLELDGVL
KSWAVPNGPSLDPADKRLAVRTEDHPLSYATFEGIIPKGEYGGGTVMLWDRGIWIPHPGK
DPRKTLEEGHLHFTLDGERMQGEWIMIRMKGRPRDRGENWILKKVTDEHAGGSMALTERF
LTSIKTGRTMQEIAAEAKAKELKSWLKGLEPKKNPPRALLGKGGVGGSAGRGPAESRNRL
QSSRQSKTGGGANGAGAPPQGAEGATSAQSAPPPRRSAARSPSPSKARGGGGQGALPLPA
FREPRKATLADHVPSGSGWIHEMKYDGYRCLLAIAGGKAKVYTRSGLDWSDKFPEIVDAA
ASLEVGSALLDGEIVSLDDKGSSSFSALQQAIGEGGRGLTLFLFDALEIDGEDVSRLPNI
ERKGRLATLVGEGKPPILLYAEHIVGHGEELFRAMCDAGQEGIISKRADASYRSARTKTW
LKIKCIQRQEFVIIGWTPSEAKARGFRSLLLAVNEDGALRYVGKVGTGFSMALIQELLAR
LKRIEVKTAPTAVPRAEALGAHWVKSELVCEIAFAEFTSEGVIRHGSFLGLRGDKKAGEV
VRELPQPIAEPSSDDIKITNPERVIFPDAGVTKQELVDYYRAIGPVMMAWAAQRPLSLVR
CPQGRDKKCFFQKHNTGSFGRHVHQIEIEEKKGQTEDYVYVDDTAGLIACVQMGTIEFHG
WGSPVADIEKPDRLIFDIDPDEGLDFAETKRAARDLHRYLADMGLQSFPLLTGGKGVHVV
VPLTPDAEWPEVKDFAQRFCIALATAEPERFTANLAKAKRKGRMFLDYLRNQRGATAIMP
YSARAREGAPVSAPISWDELDDMQSGARFSVRDSALLLERASSRALQGWGEASQTLPDL
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaacccgccaaccccctcgaaacttacaaccagaagcgcgacttcgcgaagact
gcggaaccgaagggcactttcgacaaactctcctggggcgagggccatggcttcatggtc
cagaagcacgacgccacccgcctccattacgatttccggctcgagctcgacggcgtgctg
aagagctgggcggtgcccaacggtcccagcctcgatccggccgacaagcgcctggccgtc
cgcaccgaagaccatcccctctcctacgccaccttcgaggggatcatccccaagggcgaa
tatggcggcggcacggtgatgctgtgggatcgcggcatctggatcccccatcccggcaag
gatccgcgcaagaccctggaggaaggccatctccatttcaccctcgacggcgagcggatg
cagggcgagtggatcatgatccgcatgaagggccgcccgcgcgaccgcggcgagaactgg
atcctgaagaaggtcaccgacgaacatgccggcggctcgatggccctcaccgaacgcttt
ctcaccagcatcaagaccggccgcacgatgcaggaaatcgcggcggaggcaaaggcgaag
gagctgaagagctggctcaaggggcttgagccgaagaaaaatcctccccgagctctgctc
gggaaggggggtgtaggcgggtcggcaggccgggggcctgccgagagccggaaccggctg
caaagcagccgtcagtcgaagactggtggaggggcaaacggcgccggcgccccaccgcag
ggtgcagaaggggccactagcgcccagtctgcccctccaccccgccgctccgcggcacgg
tccccctccccgagcaaagctcgaggaggaggcgggcaaggcgcccttcccctccccgcc
ttccgcgagccgcgaaaggcgacgctcgccgatcacgtcccctccggatccggctggatc
cacgagatgaaatatgacggctatcgctgcctgctggcgatcgccggcggcaaagcgaaa
gtctacacccgctccgggctcgactggtcggacaagttcccggagatcgtcgacgccgcg
gcatcgctggaggtcggctccgccttgctcgatggcgagatcgtcagcctcgacgacaag
ggctcgtcgagcttctcggcgctccagcaggcgatcggcgaaggcggccgcggtctcacc
ctgttcctgttcgatgcgctcgagatcgacggcgaggacgtgtcgcgccttcccaatatc
gaacgcaagggccgcctcgccaccctggtcggcgaaggcaagccgccgatcctgctctat
gccgagcatatcgtcggccatggcgaagagctgttccgggcgatgtgcgacgccggccag
gaagggatcatctccaagcgtgccgacgcctcctatcgttcggcgcggaccaagacctgg
ctcaagatcaagtgcatccagcgccaggaattcgtcatcatcggctggactccgagcgag
gccaaggcgcgcggcttccgctcgctgctgctcgcggtcaacgaagacggggcgttacgc
tatgtcggcaaggtcggcaccggcttctcgatggccttgatccaggaactgctcgccagg
ctgaagcggatcgaggtcaagaccgcgccgaccgccgtcccccgcgcggaggcgctcggc
gcgcattgggtcaagtccgaactggtctgcgagatcgctttcgccgaattcacctcggaa
ggggtgatccgccacggcagcttcctcggcctgcgcggcgacaagaaggccggcgaagtc
gtcagggaactgccgcagccgatcgccgagcccagcagcgacgacatcaagatcaccaat
ccggagcgcgtgatctttcccgacgccggcgtcaccaagcaggaactggtcgattattac
cgcgcaataggcccggtgatgatggcctgggcggcgcagcggccgctcagcctcgtccgc
tgcccgcagggccgcgacaagaaatgctttttccagaagcacaataccggaagcttcggc
cgccacgtccaccagatcgagatcgaggagaagaagggccagaccgaggattatgtctat
gtcgacgatactgccggcctgatcgcctgcgtgcagatgggcacgatcgaattccacggc
tggggctcgccggtggccgatatcgagaagcccgaccggctgatcttcgacatcgatccc
gacgaaggcctcgatttcgccgagaccaagcgcgccgcccgcgatctccaccgctatctc
gccgacatgggtctgcagagcttccccctgctgaccggcggcaagggcgtccacgtggtc
gtgccgctcacgcccgacgcggaatggcccgaggtcaaggatttcgcccagcgtttctgc
atcgccctggcgacggccgagcccgaacgcttcaccgccaatctcgccaaggcgaagcgc
aagggccggatgttcctcgattacctccgcaaccagcgcggcgcgaccgcgatcatgcct
tattcggcgcgcgcccgcgaaggcgcgccggtgtcggcgccgatcagctgggacgaactg
gacgacatgcaaagcggcgcccgtttcagcgtccgcgattccgcactcctgctcgaacgc
gcgtcgagccgcgccctccagggctggggcgaagccagccagactctaccggatctttaa

DBGET integrated database retrieval system