KEGG   Sphingosinicella sp. BN140058: ETR14_01225Help
Entry
ETR14_01225       CDS       T05826                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sphs  Sphingosinicella sp. BN140058
Brite
KEGG Orthology (KO) [BR:sphs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ETR14_01225 (ahpF)
Enzymes [BR:sphs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ETR14_01225 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like DAO AlaDh_PNT_C FAD_binding_3 Glutaredoxin NAD_binding_7 K_oxygenase FMO-like Thi4
Motif
Other DBs
NCBI-ProteinID: QAY79651
UniProt: A0A4V0YIW7
LinkDB All DBs
Position
278291..279871
Genome map
AA seq 526 aa AA seqDB search
MLDANLRQQLQGYMANIRQPIELVMSIDGSPKSVELNGLLEEIASLSDKVSLVRADDDER
KPSFLIRRQGTDIGVRFAGIPMGHEFTSLVLALLQVGGHPSKAAQELIEQIRDLDGDYAF
ETYFSLSCQNCPDVVQALNLMAVLNPRISHIAIDGALFQDEVNARKVMAVPTVFLNGETF
GQGRMELEQIVAKIDTAAEARTAEKIAAKDPFDVLVIGGGPAGAASAIYAARKGIRTGIA
AERFGGQVLDTMAIENFISVSHTEGPRLAAQLEQHVKDYDVDIMNLQKAEKLIPARSEGG
LHEVKLAGGASLKARTVILSTGARWRQMNVPGEDAYRNKGVTYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDSDLRADAVLQRKLASLPNVKVLTSALTTEVVGDG
EKLTGLVYKDRNHGSIHEIALEGIFVQIGLVPNTEWLRDTIALSNRGEIEVDHRGETSQR
GIFAAGDCTTVPYKQIVIAMGEGSKAALSAFDYLIRLPAAQDSLAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatctcaggcagcagcttcagggctacatggccaatatccggcagccg
atcgagctggtcatgtcgatcgacggcagcccgaaatcggtcgagctcaacggcttgctc
gaagagatcgcgtcgctctcggacaaggtcagcctggtccgggccgatgacgacgagcgc
aagcccagcttcctgatccggcgccagggcaccgacatcggggttcgcttcgccggcatc
ccgatggggcatgaattcacatcgctcgttctcgccctgctgcaggtcggcggtcacccg
tccaaggccgcgcaggagctgatcgagcaaatccgcgatctcgacggcgattacgcgttc
gagacctatttctctctttcctgccagaactgccccgacgtcgtgcaggcattgaacctg
atggcggtgctcaatccgcggatcagccacatcgcgatcgacggcgccttgttccaggac
gaagtcaatgcccgtaaggtgatggcggtcccgacggtgttcctgaacggcgagacgttc
ggccagggccggatggagctcgagcagatcgtcgccaagatcgacaccgccgcggaagcg
cggacggccgagaagatcgcggccaaggatccgttcgacgtgctcgtcatcggcggcggc
ccggccggcgcggcctcggccatctacgccgcgcgtaagggcatccgcaccggcatcgcc
gccgaacgctttggcggccaggtgctcgacacgatggcgatcgagaatttcatctcggtg
tcgcacaccgagggtccgcggctcgccgcccagctcgagcagcacgtcaaggattacgac
gtcgacatcatgaacctgcagaaggccgagaagctgatccccgcgcgcagcgaaggcggc
ctgcacgaggtcaagctcgccggcggcgcatcgctcaaggcgcggaccgtgattctctcc
accggcgcccgctggcggcagatgaacgtcccgggcgaggacgcgtatcgcaacaagggc
gtgacctattgcccgcattgcgacggcccactgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaacagcggggtcgaggcggcgatcgaccttgccggaatcgtcgcgcacgtc
accctgatcgagttcgactccgatcttcgtgccgacgcggtgctgcagcgcaagctagcc
agcctgcccaacgtcaaggtgctcacatcggccctgaccaccgaagtggtcggcgacggc
gagaaattgacggggctggtctacaaggatcgcaatcacggcagcatccacgaaatcgcc
ctggagggcattttcgtccagatcgggcttgttccgaacaccgagtggctgcgcgatacg
atcgcgctgagcaatcgcggcgaaatcgaagtcgatcatcgcggcgagacttcgcagcgc
ggcatcttcgcggcgggcgactgcaccaccgtgccctacaagcagatcgtcatcgcgatg
ggcgaaggttcgaaggccgctctctccgccttcgattacctcattcgcctgcccgcggcc
caggacagcctcgccgcctga

DBGET integrated database retrieval system