KEGG   Sphingosinicella sp. BN140058: ETR14_15000Help
Entry
ETR14_15000       CDS       T05826                                 

Definition
(GenBank) phosphoribosylglycinamide synthetase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sphs  Sphingosinicella sp. BN140058
Pathway
sphs00473  D-Alanine metabolism
sphs00550  Peptidoglycan biosynthesis
sphs01100  Metabolic pathways
sphs01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sphs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ETR14_15000
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ETR14_15000
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ETR14_15000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sphs01011]
    ETR14_15000
Enzymes [BR:sphs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ETR14_15000
Peptidoglycan biosynthesis and degradation proteins [BR:sphs01011]
 Precursor biosynthesis
  Amino acid ligase
   ETR14_15000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_4 GARS_A ATP-grasp_3 DNA_pol3_theta
Motif
Other DBs
NCBI-ProteinID: QAY77672
UniProt: A0A4P6FME1
LinkDB All DBs
Position
complement(3347406..3348416)
Genome map
AA seq 336 aa AA seqDB search
MPQPIEPRAIPQEAKERLRILFIAKHALWDGGLHPDDGNHALYHLETREILTGLGLNLSL
ADRYDALFDRPDVDFVFPLLNRGGFLNSEMMLPLLCTRAGLPFLGASPILRGLADDKHLT
KLAVRARGVPTAAWAIYRRGAPVDPARCPDGSRLVVKPNASSASWGVQDAHDWSGAAAAV
ARIHGEGHDAIVEPFLDGSDVEVPVITVDGEPVIMPMMLFEQADPTHLRTYYEKRDLVDR
AQKYRLVPFDDSEWVPIITAYVRAIAEEFRPFDYGRFEFRLDRERGVVRFLEVNLQANLW
SQKVYGRSAALAGLSQSQLIETILYESLRRHHLLER
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgccccagccgatcgaaccccgtgccattccgcaggaggcgaaggagcggctgcgcatc
ctgttcatcgccaagcatgcgctctgggacggcggactgcaccccgacgacggcaatcac
gctctctatcatctggaaacgcgcgaaattttgaccgggctcggtctcaacctcagtctc
gccgatcgctacgatgctctgttcgaccggcccgatgtcgatttcgtctttccgctgctc
aaccggggcggcttcctcaacagcgaaatgatgctgccgttgctgtgcacccgcgccggc
ctccctttcctcggcgcatcgccgatcctgcgcggcttggccgacgacaaacacctgacc
aagttggcggtgcgagcgcgcggggtgccgaccgcggcctgggcgatctaccggcgcggt
gcccccgtcgatccggcgcgctgccccgacggcagccggctggtggtcaaacccaatgcc
tcgtcggcgagctggggcgtgcaggacgcgcacgattggtccggcgccgcagcggccgtc
gcccgcatccacggcgaaggtcacgatgccatcgtcgagccgttcctcgacggcagcgac
gtcgaagtgccggtgatcaccgtcgacggcgagcccgtgatcatgccgatgatgctgttc
gaacaggcggatccgacccaccttcgcacctattacgagaaaagggatctcgtcgaccgc
gcgcaaaaatatcggctggtgccgttcgacgattcggaatgggtcccgatcatcaccgcg
tatgtccgtgcgattgcggaggaattccgcccattcgattatggccgattcgaattccgg
ctcgatcgcgagcgcggcgtcgtccgctttctggaggtcaaccttcaggcgaatctgtgg
tcgcagaaggtctacggccgatcggctgccctcgccggcctcagccaatcgcaactgatc
gagaccatcctgtacgaaagcctgcgtcgtcatcatctcctggagcgttga

DBGET integrated database retrieval system