KEGG   Sphingosinicella sp. BN140058: ETR14_15080Help
Entry
ETR14_15080       CDS       T05826                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sphs  Sphingosinicella sp. BN140058
Pathway
sphs00010  Glycolysis / Gluconeogenesis
sphs00020  Citrate cycle (TCA cycle)
sphs00620  Pyruvate metabolism
sphs01100  Metabolic pathways
sphs01110  Biosynthesis of secondary metabolites
sphs01120  Microbial metabolism in diverse environments
sphs01130  Biosynthesis of antibiotics
sphs01200  Carbon metabolism
Module
sphs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sphs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETR14_15080
   00020 Citrate cycle (TCA cycle)
    ETR14_15080
   00620 Pyruvate metabolism
    ETR14_15080
Enzymes [BR:sphs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ETR14_15080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: QAY77687
UniProt: A0A4P6FTB1
LinkDB All DBs
Position
3365678..3367030
Genome map
AA seq 450 aa AA seqDB search
MPIELKMPALSPTMEEGTLAKWLVKEGDTVAAGDLLAEIETDKATMEFEAVDEGTIAKIL
VAEGTDEVKVGTVIALIAAEGEDVSAASAPTAAAEPVAKGGGETGAGQPATPTPAPDVKG
YGANPAEDKKIAAATSPSTAGGTVGSGDRVKASPLARRIAEQKGIDLAAVKGTGPGGRIV
KVDIDGARPGQAAPAQATAPAAAAGAPQAPAQPAAPATIPDIPHEAVKLSNIRKTIARRL
TESKQNVPHIYLTVDIQLDKLLKLRSELNAGLEGRGVKLSVNDMLIKALAAALMEVPSCN
VMYTGTELVTFKRADISVAVSTPTGLITPIVAQADTKSLSAIATEIKELAGRAREGKLKP
EEYQGGTASLSNMGMYGIKQFEAVINPPQGMIMAIGAGEKRPYVIDDSLQIATVMSATGS
FDHRAIDGADGAQLMQAFKRLVENPLGMLA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgaactgaaaatgcccgccctctcgcccaccatggaggaggggactcttgcc
aagtggctggtcaaggagggcgacaccgtcgccgccggcgacctgctcgccgaaatcgag
accgacaaggcgacgatggaattcgaagccgtcgacgagggcacgatcgccaagatcctg
gtcgccgagggcaccgacgaagtgaaggtcggcaccgtgatcgcgctgattgccgccgag
ggcgaggatgtcagcgccgcctccgcaccgaccgcggcggccgagccggtggcgaagggc
ggcggcgagaccggcgccggccagcccgcaaccccgactccggcgccggatgtgaagggc
tatggcgcgaacccggccgaggacaagaagattgccgcggcaacctctccctcaacggcg
ggcggcaccgtcggcagcggcgaccgggtcaaggcgagtccgcttgcccggcgcatcgcc
gagcagaagggcatcgatctcgccgccgtgaagggcaccggccccggcggccgaatcgtc
aaggtggacatcgacggcgcccgtcccggccaggccgcccctgcccaggcgacggcacca
gccgctgccgccggcgcgccgcaggccccggcgcagccggccgcgcccgcgacgatcccc
gacattccgcacgaagcggtcaagctgtcgaacatccgcaagacgatcgcgcggcggctc
accgaatcgaagcagaacgtcccgcacatctatctcaccgtcgatatccagctcgacaaa
ttgctcaagctccggtccgagctcaacgccgggctcgagggtcgcggcgtgaagctgtcg
gtcaacgacatgctcatcaaggcgctggcggcggcattgatggaggtgccgagctgcaac
gtcatgtacaccggcaccgaactcgtcaccttcaagcgtgccgacatttcggtggcggtg
tcgaccccgaccgggctgatcacgccgatcgtcgcccaggccgacaccaagtcgctgtcg
gcgatcgcgacggagatcaaggaacttgccggccgcgcccgcgaaggcaagttgaagccc
gaggaatatcagggcggcaccgccagcctcagcaacatgggcatgtacgggatcaagcag
ttcgaggccgtgatcaatccgccgcagggcatgatcatggcgatcggcgccggcgagaag
cgcccctacgtgatcgacgacagcctccagatcgcgaccgtgatgagcgccaccggcagc
ttcgaccaccgcgcgatcgacggcgccgacggcgcccagctgatgcaggcgttcaagcgc
ctggtcgaaaacccgctgggcatgctggcctaa

DBGET integrated database retrieval system