KEGG   Sphingosinicella sp. BN140058: ETR14_15520Help
Entry
ETR14_15520       CDS       T05826                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sphs  Sphingosinicella sp. BN140058
Pathway
sphs00473  D-Alanine metabolism
sphs00550  Peptidoglycan biosynthesis
sphs01100  Metabolic pathways
sphs01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sphs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ETR14_15520
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ETR14_15520
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    ETR14_15520
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sphs01011]
    ETR14_15520
Enzymes [BR:sphs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ETR14_15520
Peptidoglycan biosynthesis and degradation proteins [BR:sphs01011]
 Precursor biosynthesis
  Amino acid ligase
   ETR14_15520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: QAY77767
LinkDB All DBs
Position
3463815..3464756
Genome map
AA seq 313 aa AA seqDB search
MTDKLHVAVLMGGWSAERPVSLMSGAGVADALESLGHRVTRIDMGRDVAARLAEAKPDVV
FNALHGTPGEDGTVQGMMDLMGLTYTHSGLVTSVIAIDKELTKQQLVPNGIRMPGGHIVE
SETLFEGDPMPRPYVVKPVNEGSSVGVAIVTDSGNYGQPIARSTPGPWTEFDRLLAEPFI
KGRELTVAVLGDEALAVTELRTKSGFYDFDAKYTEGLTEHVCPADIPDGVRDAALAMALE
AHRLLGCRGCSRSDFRWDEEEGESGLYLLEVNTQPGMTPLSLVPEQAKYRGMSYPQLVQR
IVDEALRTGGGTE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacaagctgcacgtcgccgttctgatgggcggctggtccgcggagcggccggtc
tcgctgatgagcggcgccggcgttgccgacgcgctggagagcctcggtcacagggtcacc
cgcatcgacatggggcgcgatgtcgccgcgcgcctggccgaggccaagcccgacgtcgtc
ttcaacgcgctgcacggaacgccgggtgaggacggtaccgtccagggcatgatggacctg
atgggcctcacctacacccattcgggcctcgtcacgtcggtgatcgcgatcgacaaggaa
ctgaccaagcagcagctggtgccgaacggcatccgcatgccgggcggccacatcgtcgaa
agcgagactctgttcgaaggcgatccgatgccgcggccgtacgtcgtcaagccggtcaac
gaaggctcttcggtcggcgtcgcgatcgtgaccgacagcggcaattacggccagcccatc
gcccgcagcacgcccgggccctggaccgaattcgatcgcctgctcgccgagccgttcatc
aaggggcgcgaactcaccgtcgcggtgctgggcgatgaggcgctcgccgtcaccgagctc
cggaccaaatcaggcttctacgatttcgacgccaaatataccgaaggtctcaccgagcat
gtctgcccggccgacataccggacggcgtgcgcgacgccgcgctcgcaatggctctggag
gcacatcgtctgcttggctgccgcggctgctcgcgctccgactttcgctgggatgaggaa
gagggtgaaagcggcctctatcttctcgaggtcaacacccagcccggcatgaccccgctc
agcctggtgccggagcaggcgaaatatcgcggcatgtcgtatccgcagctggtgcagcgc
atcgtcgacgaagcgcttcggacagggggagggacggagtga

DBGET integrated database retrieval system