KEGG   Sphingobium sp. TKS: K426_07260Help
Entry
K426_07260        CDS       T04965                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
spht  Sphingobium sp. TKS
Pathway
spht00473  D-Alanine metabolism
spht01100  Metabolic pathways
spht01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spht00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    K426_07260
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    K426_07260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spht01011]
    K426_07260
Enzymes [BR:spht01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     K426_07260
Peptidoglycan biosynthesis and degradation proteins [BR:spht01011]
 Precursor biosynthesis
  Racemase
   K426_07260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AMK22399
UniProt: A0A126RJX0
LinkDB All DBs
Position
1:complement(1434371..1435501)
Genome map
AA seq 376 aa AA seqDB search
MQPVDTAGAVLRIDLDALAENYRIIQRQVAPATVAGVVKADGYGLGADIVAETLMDAGCR
HFFVAHLSEAVALKPTLGEEISLFILNGLQPGAERDCAAIGAIPVLNSLDQLGRWAMFAQ
ERGQSLPAALQVDSGMSRLGLPPEEVAILAAEPERLEGIDLRLLMSHLACADNSDAAFNA
TQRANFEALSQHFPGVPRSLANSGGSFLKGRHFDIVRAGIALYGGAPQEGLHLMRPVVAL
EARIIQLRSIPTGAGVGYGLTHRCERPTQIATIAVGYADGWPRHLSNSGSAFIAGHRAPI
VGRVSMDSITLDVTDVPDMFLYPGAPVELLGPHQTVDQVAADAGTISYEILTQLGHRYRR
DIQRTAAIQHRRSMTA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctgttgatactgccggggccgtgcttcgcatcgatctggacgcgttggccgaa
aattaccggatcattcagcggcaagtcgcgcctgcaaccgttgctggcgtggtcaaggcg
gatggctatggcctgggcgcggacatcgttgccgaaacattgatggatgcgggatgccgc
catttcttcgtcgcgcatctcagcgaagcggtggcgctcaaacccacgcttggggaggaa
atctcgctattcatcctcaacggcctgcaacccggcgccgagcgggattgcgcggccatc
ggagcgattccggtcctgaactcgctcgatcaacttgggcgctgggccatgttcgcgcag
gaacgggggcagagcctgcccgcagcgttgcaagtcgacagcggcatgtcgcggctcggc
ctgccccccgaagaggtcgccatcctcgccgcagagcctgagcggctggagggcatagac
ctccggctgctgatgagtcatctggcttgcgcggataattccgatgccgccttcaacgcc
acgcaacgcgcgaatttcgaggcgttgagccagcatttccccggcgtgccgcgttcgctg
gccaatagcggcggcagtttcctgaaaggcaggcatttcgacatcgtccgtgccgggatc
gccctttatggcggggcaccgcaagaaggactccacctcatgcggccggtggtcgcgctg
gaggcgcggatcatccagttacggagcatccccacgggcgcgggcgtcggctatggcctg
acccaccgctgcgagcggcccacgcagatcgcgaccatagcggtcggctatgccgacggc
tggccgcgccatctcagcaacagcggttccgccttcatcgcgggccatcgcgcgccgatc
gtggggcgggtatcgatggacagcatcacgctggacgtgaccgatgtgccggacatgttt
ctctatcccggcgccccagtggaattgctcggcccccatcagacagtggaccaggtcgcc
gccgacgccggcaccatttcctatgaaatcctgacccaactcggacatcgctatcgccgc
gacattcaaaggacggcggcgatccagcacagacggagcatgacagcatga

DBGET integrated database retrieval system