KEGG   Sphingobium sp. TKS: K426_07590Help
Entry
K426_07590        CDS       T04965                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
spht  Sphingobium sp. TKS
Pathway
spht00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:spht00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    K426_07590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spht02000]
    K426_07590
Enzymes [BR:spht01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     K426_07590
Transporters [BR:spht02000]
 Other Transporters
  Pores ion channels [TC:1]
   K426_07590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 DSX_dimer
Motif
Other DBs
NCBI-ProteinID: AMK22465
UniProt: A0A126RLJ0
LinkDB All DBs
Position
1:complement(1489860..1490492)
Genome map
AA seq 210 aa AA seqDB search
MPNAITFYTNPMSRGQIVRWMLEEVGQPYEMVVLDYGENGMKSANYLAINPMGKVPAIVH
AGKVVTECAAICAYLADAFPAAGLAPSTDDRADYYRWLFFAAGPVEAAITNKALGFVVPE
DRERMAGYGTFDHTIDALESAVSGPAWICGDQFTAADVYVGAQVDWGLSFGTIPSRPPFE
AYAARLRERPAYKRQKELDNALIAEMQKPA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatgcaatcaccttctacaccaaccccatgtcgcgcgggcagatcgtccgctgg
atgctggaggaagtcggccagccttatgaaatggtggtgctggactatggcgagaacggc
atgaagtccgccaattatctagcgatcaacccgatgggcaaggttccggccatcgtccat
gccggcaaggtggtgacggaatgcgccgccatctgcgcctatctggcggacgctttcccc
gccgcgggccttgcgccctccaccgatgaccgtgccgactattatcgctggctcttcttt
gcggcggggccggtcgaggccgccatcaccaataaggcactcggctttgtcgttcccgaa
gaccgcgagcgcatggcgggctatggcacattcgaccacacgatcgatgccctggaaagc
gccgtttccggcccggcctggatttgcggcgatcagttcaccgccgccgacgtctatgtc
ggcgcgcaggtcgattggggtctcagcttcggcacgatccccagccgtccgcccttcgaa
gcctatgccgcccgcctgcgggaacgcccggcctataagcgacagaaggaactggacaac
gccctgatcgcggaaatgcagaagcccgcctga

DBGET integrated database retrieval system