KEGG   Sphingobium sp. TKS: K426_08190Help
Entry
K426_08190        CDS       T04965                                 

Definition
(GenBank) glutamine amidotransferase of anthranilate synthase
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
spht  Sphingobium sp. TKS
Pathway
spht00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spht01100  Metabolic pathways
spht01110  Biosynthesis of secondary metabolites
spht01130  Biosynthesis of antibiotics
spht01230  Biosynthesis of amino acids
spht02024  Quorum sensing
Module
spht_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spht00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    K426_08190
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    K426_08190
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    K426_08190
Enzymes [BR:spht01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     K426_08190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AMK22583
UniProt: A0A126RK31
LinkDB All DBs
Position
1:complement(1608945..1609541)
Genome map
AA seq 198 aa AA seqDB search
MILVIDNYDSFTWNLVHYLMELGAQVEVVRNDAISAGQALSTGAQAFLLSPGPCTPNEAG
VSLDLVAACADAGAPLLGVCLGHQSIGQHFGGKVVRGGLMHGKTSPVSHDGTGLFEGLPS
PFTATRYHSLIVEDIPDSLIVNATSEDGSVMGFRHRDLPIHSVQFHPESIATEHGHDMLA
NFMRIAGIPVQERAAALS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgtcatcgacaattacgacagcttcacctggaacctggtccattacctcatg
gaactgggcgcgcaggtggaggtcgtccgcaacgacgccatttccgccggtcaggcgctc
tccaccggcgcacaggccttcctgctgtcgcccggcccctgcacccccaatgaggcgggc
gtcagccttgatctcgtcgccgcctgcgcggacgcgggcgcgcctttgctgggcgtatgc
cttggccaccagtcgatcgggcagcatttcggcggcaaggtggtgcgcggcggcctgatg
catggcaagacctcccccgtcagccatgacggcaccgggttgttcgaagggctcccctcg
cccttcaccgcgacccgctatcactcgctgatcgtcgaggacattcccgacagcctgatc
gtcaacgccaccagcgaagacggatcggtcatgggcttccgccaccgcgacctgccgatc
cattcggtccagttccacccggaaagcatcgccaccgaacatggccatgacatgctggcg
aacttcatgcggatcgcgggcatcccggttcaggaacgcgccgccgcgctttcatag

DBGET integrated database retrieval system