KEGG   Sphingobium sp. TKS: K426_16800Help
Entry
K426_16800        CDS       T04965                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
spht  Sphingobium sp. TKS
Brite
KEGG Orthology (KO) [BR:spht00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    K426_16800
Enzymes [BR:spht01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     K426_16800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_3 HI0933_like AlaDh_PNT_C FAD_binding_2 NAD_binding_7 NAD_binding_8 DAO Thi4 Glutaredoxin FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AMK24292
UniProt: A0A126RQD2
LinkDB All DBs
Position
1:3398425..3400017
Genome map
AA seq 530 aa AA seqDB search
MLDANLKGQLKAYMANITQPIELVASLDEGAKSRELKTLLDEIAELSDKVSITTGPKTDS
TKRVPSFMIRRTGTDIGVTFAGLPMGHEFTSLVLALLQVGGHPSKAAQELLQQIKDIDGD
FAFETYFSLSCQNCPDVVQALNLMAVLNPRISHTAIDGALFKEEVDARKVMAVPTVFLNG
EPFASGRMELEQIVAKIDSGAATRAAEKIKAQDPFEVLIVGGGPAGAAAAIYAARKGIRT
GVAAERFGGQVLDTMDIENFISVSRTEGPKFAAALEAHVKDYDVEIMNLQKAAKLIPAKT
EGGYHEVVLGNGASLKGKTVILSTGARWRQMGVPGEDEYRNKGVAYCPHCDGPLFKGKRV
AVIGGGNSGVEAAIDLAGIVAHVTLIEYDSQLRADAVLQRKLASLPNVRIITSALTTKVD
GNGERVTGLSYKDRNSGTEHDIELEGIFVQIGLVPNTEWLKDTIALSPRGEIEIDARGET
SQPGIFAAGDCTTVPYKQIVIACGAGSTAALSAFDYLIRLPAAEETAEAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcaaatctcaagggccagctcaaggcctatatggcgaacatcacccagccg
atcgagctggtggcgtcgctggacgaaggcgcgaagagccgtgaactcaagacgctgctg
gatgagatcgccgaactgtcggacaaggtatccatcaccaccggcccaaaaaccgatagc
accaagcgcgtccccagcttcatgatccgccgtaccggcacggacatcggcgtgaccttc
gccggcctgcccatgggccatgaattcacctcgctcgtcctcgccctgctgcaagtcggc
ggccacccgtccaaggcggcgcaggaactgctccagcagatcaaggacatcgacggtgac
ttcgccttcgaaacctatttctcgctgtcctgccagaactgccccgatgtggtgcaggcg
ctgaacctgatggccgtcctcaacccccgcatcagccacaccgccatcgacggcgcgcta
ttcaaggaagaagtcgacgcccgcaaggtcatggccgtccccaccgtcttcctgaacggc
gaacccttcgccagcggccggatggaactggagcagatcgtcgcgaagatcgacagcggc
gcggccacccgcgcagcggagaagatcaaggcgcaagacccgttcgaagtgctgatcgtc
ggtggcggtcccgctggcgctgcggcggcgatctatgcggcgcgcaagggcatccgcacc
ggcgtcgcggcggagcgcttcggcggtcaggtgctcgacaccatggatatcgagaatttc
atctcggtcagccgcaccgaaggccccaaattcgccgccgcgctggaagcccatgtgaag
gactatgacgtcgagatcatgaacctgcagaaggccgccaagctgatcccggccaagacc
gaaggcggctatcatgaggtcgtgctgggaaatggcgcgtccttgaagggcaagaccgtc
attctctccaccggcgcgcgctggcggcagatgggcgtgcccggcgaagacgaatatcgc
aacaagggcgtggcctactgcccgcattgcgacggcccgctgttcaagggcaagcgcgtg
gcggtgatcggcggcggcaatagcggcgtcgaggcggccatcgacctggccggcatcgtc
gcccatgtgactctgatcgagtatgacagccagctccgcgccgacgccgtgctccagcgc
aaactcgccagcctgcccaatgtcaggatcatcacctcggccctcacgaccaaggtggac
ggcaatggcgaacgcgtcaccggcctcagctacaaggatcgcaacagcggcacggagcat
gatatcgaactggaaggcattttcgtccagatcggcctcgtcccgaacaccgaatggctg
aaagacacgatcgccctttccccacgtggcgagatcgagatcgacgcgcgcggcgaaacc
agccagcccggcatcttcgcggcgggcgactgcacgactgtgccctacaagcagatcgtg
atcgcttgcggagcgggctcgacggcggcgctctccgccttcgattacttgatccgcctg
ccagcggcggaggagaccgccgaagcggcctga

DBGET integrated database retrieval system