KEGG   Sphingobium sp. TKS: K426_27325Help
Entry
K426_27325        CDS       T04965                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
spht  Sphingobium sp. TKS
Pathway
spht00010  Glycolysis / Gluconeogenesis
spht00071  Fatty acid degradation
spht00350  Tyrosine metabolism
spht00625  Chloroalkane and chloroalkene degradation
spht00626  Naphthalene degradation
spht01100  Metabolic pathways
spht01110  Biosynthesis of secondary metabolites
spht01120  Microbial metabolism in diverse environments
spht01130  Biosynthesis of antibiotics
spht01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    K426_27325
  09103 Lipid metabolism
   00071 Fatty acid degradation
    K426_27325
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    K426_27325
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    K426_27325
   00626 Naphthalene degradation
    K426_27325
Enzymes [BR:spht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     K426_27325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AMK26363
UniProt: A0A126RVY8
LinkDB All DBs
Position
pTK1:complement(433475..434500)
Genome map
AA seq 341 aa AA seqDB search
MAKTMKAAVVREFGKPLVIEDAPIPTVGPGQILVKIAATGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGHVAAVGAGVTHVKEGDRVGVPWLYTACGHCVHCLGGWETLCHEQQNTGYSV
NGSFAEYVLADPNYVGHLPDNVDFLDIAPILCAGVTVYKGLKATEARPGEWVVVSGIGGL
GHMAVQYARAMGLNVAAVDIDDSKLDLATRLGATLTVNAHSEDPSAALKKAIGGAHGALV
TAVSPKAFQQALGMVRRGGTVALNGLPPGDFPLSIFDTVLNGITVRGSIVGTRLDLLEAL
AFAGDGKVKATVHADKLENINDVFSRMHHGDIEGRIVLDLA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaccatgaaggcggcggtcgtccgcgaattcggcaagcccctggtcatcgag
gacgcgccgatcccgacggtcggccccgggcagatcctggtcaagattgcggcaaccggc
gtgtgccataccgacctgcacgcggcagaaggggactggccggtcaaacccaacccgccc
ttcattcctggccatgaaggcgtcgggcatgtcgccgccgtcggtgcgggcgtcacccat
gtgaaggaaggcgaccgggtcggcgtgccctggctctacaccgcctgcgggcattgcgtg
cattgcctgggtggctgggagacgctttgccacgaacagcagaacaccggctattcggtc
aatggcagctttgccgaatatgtcctcgccgatcccaactatgttggtcaccttcccgac
aatgtcgacttcctcgacattgcgccgatcctctgcgcgggcgtcaccgtctacaaggga
ttgaaggccaccgaggcccgacccggcgagtgggtggtcgtctcagggatcggcgggctc
ggccacatggcggtgcaatatgcccgtgccatgggtctcaatgtggccgcggtcgacatc
gacgatagcaagctcgacctcgctacacgccttggcgccacactgacggtcaacgcgcac
agcgaggacccttcggcagcgctcaagaaggcgataggcggcgcgcacggagcgctcgtc
accgccgtttcgcccaaggcgttccagcaggcgctcggcatggtccggcgcggcggcacg
gtcgcgctcaatggtctgccgccgggcgacttcccgctgtcgatcttcgacaccgtgctg
aacggcattaccgtgcgaggctcgatcgtcggcacgcggctcgatctgctcgaggcactg
gcgttcgccggcgacggcaaggtcaaggccacggtccatgcagacaagctggagaacatc
aacgacgtcttctcccgcatgcaccatggcgacatcgagggccggatcgtcctcgacctc
gcctga

DBGET integrated database retrieval system