KEGG   Uncultured Sphingopyxis sp. UC10: SPPYR_0042Help
Entry
SPPYR_0042        CDS       T05531                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sphu  Uncultured Sphingopyxis sp. UC10
Pathway
sphu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sphu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SPPYR_0042
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sphu03400]
    SPPYR_0042
Enzymes [BR:sphu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SPPYR_0042
DNA repair and recombination proteins [BR:sphu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SPPYR_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: SBV31162
UniProt: A0A1Y5PM91
LinkDB All DBs
Position
SPPYR:complement(50280..52784)
Genome map
AA seq 834 aa AA seqDB search
MSRADPLAQYNAKRDFKLTPEPAGKVEKGAGNRFIVQKHDATRLHYDFRLEVDGVLKSWA
VTKGPSADPADKRLAVRTEDHPMSYADFEGVIPKGEYGGGSVMLWDRGTWAPVAGKSAKD
IEKGHLHFTLDGERMKGEWLLVRMKPRGNEKRENWLLRKVNDAYAGGTDDLVGRQLTSIL
TGRTMAEIAGDEGGEQSLKGAKGAAFAKKMAAAAAHNKKVAKAKPKAKLPKFRPLQLATL
VDAVPAGNGWFHEIKYDGYRAEIAASGGDVRVYTRNGLDWTDKFAPLVRHIAALDLPPCL
IDGEIVAYGKEGNPDFSSLQAVLKRGHGAQDEATRLHFFAFDLLEEDGKSLAKLGNLERK
ERLEALLRDAKAPVAVADHVIGAGETLHAAMCGAGQEGIISKRADAAYVGRRTKNWVKVK
CTRRQEFVLVGWKPSSTRARPFSSLLLAQHEGGSLVYKGNVGTGFDAGTMADLAKAFAKL
ERKTAPLEVDKVAARKVHWLKPELVAEIAFAEFTASGSVRHASFLGLRSDKEAIEVTPEV
KQPAPEAQSDVRISSRDRVIFPEAKATKGDLADYYAAIAPLMLPHMARRPVSLVRCPQGR
AKKCFFQKHDSGSFGDHVHHVPIKEKDGGHEDYLYIEDADGILACVQMGTIEFHGWDSHV
ETLEKPDRMVFDLDPDEDLDFADVKKAALDIRRQLADIGLVSFAMLSGGKGVHVVVPLDP
EHGWDAHKDFSKRFAEALSLAEPDRYVATMSKAKRKGKIFIDWLRNQRGSTAIMPYSARA
REGAPAAVPIGWDALADARKAGQWTIKDAGELLERAARADLKGWGFASQPLPAF
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcgctgaccccctcgcccaatataacgccaagcgcgatttcaagctgactccc
gagcccgcgggcaaggtcgaaaaaggtgccggcaaccgcttcatcgtccagaagcatgat
gcgacgcggctccattacgacttccggctcgaagtcgacggcgtgctcaaaagctgggcg
gtcaccaagggcccgagcgccgaccccgccgacaagcgcctcgcggtgcgcaccgaggat
cacccgatgtcctacgccgatttcgaaggcgtgatccccaagggcgaatatggcggcggc
agcgtgatgctgtgggaccgcggcacctgggcgccggtcgcgggcaagagcgcgaaggac
atcgaaaagggccacctccatttcaccctggatggcgagcggatgaagggcgaatggctg
ctcgtccgcatgaagccgcgcgggaacgagaagcgcgagaactggctgctccgcaaagtg
aacgacgcctatgccggcggcaccgacgacctcgtcgggcgccagcttacgagcatcctc
accggccgcaccatggccgagatcgcgggcgacgaaggcggcgaacaatcgctgaagggc
gcgaagggggcggcgttcgcgaagaagatggccgccgcggccgcgcacaacaaaaaggtc
gccaaggcgaaaccgaaagccaaactccccaaattccgcccgctccagctcgcgacgctc
gtcgacgccgtgccggcgggcaacggctggtttcacgagatcaaatatgacggctaccgc
gccgagatcgccgcatcgggcggcgacgtgcgggtctacacaaggaatggtctcgactgg
accgacaagttcgcgccgctcgtccgccatattgccgcgctcgacctgccgccgtgcctg
atcgacggcgagatcgtcgcctatggcaaggagggcaatcccgacttctcctcgctccag
gcggtgctcaagcgcggccatggcgcgcaggacgaggccacccggctccacttcttcgcc
ttcgacctgctcgaagaagacggcaagtcgctggcgaagctcggcaatctcgaacgcaag
gaacggctcgaagccctgctccgcgacgcgaaggcgccggtcgcggtcgccgaccatgtc
atcggcgcgggcgagacgcttcacgccgcgatgtgcggcgcggggcaggaaggcatcatc
tcgaaacgcgccgacgcggcttacgtcggccgccgcaccaaaaactgggtgaaggtcaaa
tgcacgcggcggcaggagttcgtcctcgtcggctggaagccctcctcgaccagggcgcgc
cccttctcgtcgctgctcctcgcgcagcacgagggcggcagtctcgtctacaagggcaat
gtcggcaccggcttcgatgccggcaccatggccgacctcgccaaggcattcgcgaaactc
gaacgcaagaccgcgccgctcgaggtcgacaaagtcgccgcacgcaaggttcactggctg
aaacccgaactcgtcgccgaaatcgccttcgccgaatttaccgcgagcggatcggtgcgc
cacgcgagcttcctcggcctgcgcagcgacaaggaggcgatagaggtgacccccgaagtg
aaacagcccgcgcccgaagcgcaaagcgacgtcaggatcagcagccgcgaccgcgtcatc
tttcccgaagccaaagcgaccaagggcgatctcgccgactattacgccgcgatcgccccg
ctcatgctcccgcacatggcgcggcgcccggtcagcctcgtccgctgtccgcaggggcgc
gcgaagaaatgctttttccagaagcatgactcgggcagcttcggcgaccatgtccatcac
gtcccgatcaaggagaaggacggcgggcacgaggattatctctatatcgaggatgccgac
ggcatcctcgcctgcgtccagatggggacgatcgaatttcacggctgggacagccatgtc
gaaaccctcgaaaagcccgaccgcatggtgttcgacctcgatcccgacgaagacctcgat
ttcgccgatgtcaaaaaggccgcgctcgacatccgccgccagctcgccgacatcggcctc
gtcagcttcgcgatgctctcgggcggcaagggcgtgcatgtcgtcgtgccgctcgatccc
gagcatggctgggacgcgcacaaggatttctcaaaacgcttcgccgaggcgctgagcctc
gccgagcccgaccgctatgtcgcgacgatgagcaaggcgaagcgcaagggcaagatcttc
atcgactggctgcgcaaccagcgcggcagcaccgcgatcatgccctattcggcgcgcgcg
cgcgaaggcgccccggccgcggtcccgatcggctgggacgcgctcgccgatgcccgaaag
gcggggcagtggacgatcaaggacgccggcgaactgctcgaacgcgccgcgcgcgccgac
ctcaagggctggggtttcgccagccagcccctccccgctttctga

DBGET integrated database retrieval system