KEGG   Uncultured Sphingopyxis sp. UC10: SPPYR_0914Help
Entry
SPPYR_0914        CDS       T05531                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sphu  Uncultured Sphingopyxis sp. UC10
Pathway
sphu00473  D-Alanine metabolism
sphu00550  Peptidoglycan biosynthesis
sphu01100  Metabolic pathways
sphu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sphu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SPPYR_0914 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPPYR_0914 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    SPPYR_0914 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sphu01011]
    SPPYR_0914 (ddl)
Enzymes [BR:sphu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SPPYR_0914 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:sphu01011]
 Precursor biosynthesis
  Amino acid ligase
   SPPYR_0914 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 Rimk_N
Motif
Other DBs
NCBI-ProteinID: SBV32034
UniProt: A0A1Y5PXR4
LinkDB All DBs
Position
SPPYR:988443..989369
Genome map
AA seq 308 aa AA seqDB search
MSRGPWHVAVLMGGWSAEREVSLMSGKGIADALESRGHRVTRIDMDRDVALRLADAKPDV
VFNALHGVPGEDGTVQGMLDLMGLKYTHSGLVTSVIAIDKELTKQALVPHGIPMPAGTMV
DSESLFSVDPLPRPYVLKPVNEGSSVGVAIVRDDSNYGNPIARDAVGPWQEFDRLLAEPF
IKGRELTVAVLGDQALGVTELRVKSGFYDYDAKYTDGLTEHVCPADVPADVAQRMKDLAL
QAHRLLGCKGASRSDFRWDDEHGLAGIFLLEVNTQPGMTPLSLVPEQARAVGMDYAELVE
RIVGEALI
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagccggggtccgtggcatgtcgccgtcctgatgggcggctggtccgccgagcgcgaa
gtgtcgctgatgagcggcaagggcatcgccgacgcgctcgaatcgcgcgggcatcgggtc
acgcgcatcgacatggaccgcgacgtcgcgctgcggctcgccgacgcgaagcccgacgtc
gtgttcaacgcgctccacggcgtcccgggcgaggatggcaccgtgcagggcatgctcgac
ctgatgggcctcaaatatacccacagcggcctcgtcacctcggtgatcgcgatcgacaag
gaattgacgaaacaagccttggtgccgcatggaatccccatgccggcggggacgatggtc
gacagcgaaagcctcttttcagtcgaccccttgccgcgcccctatgtgctgaaacccgtc
aacgaaggctcgtcggtcggcgtcgcgatcgtcagggacgacagcaattacggcaacccg
atcgcgcgcgatgcggtggggccgtggcaggaattcgaccgcctgctcgccgaacccttc
atcaagggtcgcgagctgaccgtcgcggtgctcggcgaccaggcgctcggcgtgaccgag
ctgcgcgtcaagtcaggcttctacgactatgacgccaaatataccgacggcctcaccgaa
catgtctgccccgccgacgtccccgccgacgtcgcgcagcggatgaaggatctcgcgctt
caggcgcaccgcctcctcggctgcaagggcgcctcgcgctcggattttcgctgggacgac
gaacatggcctcgcgggcatcttcctgcttgaggtcaacacccagcccggcatgacgccg
ctcagcctcgtgcccgaacaggcgcgggcggtgggtatggattatgccgaactcgtcgaa
cgcatcgtgggggaggcgctcatatga

DBGET integrated database retrieval system