KEGG   Uncultured Sphingopyxis sp. UC10: SPPYR_2616Help
Entry
SPPYR_2616        CDS       T05531                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F52a subunit, FAD/NAD(P)-binding
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sphu  Uncultured Sphingopyxis sp. UC10
Brite
KEGG Orthology (KO) [BR:sphu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPPYR_2616 (ahpF)
Enzymes [BR:sphu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SPPYR_2616 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like FAD_binding_3 AlaDh_PNT_C NAD_binding_7 Glutaredoxin Thi4 K_oxygenase DAO FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: SBV33736
UniProt: A0A1Y5PYH9
LinkDB All DBs
Position
SPPYR:complement(2763630..2765291)
Genome map
AA seq 553 aa AA seqDB search
MPMLDANTTAQLKSYLGNLRRPIELVASLDASPKSAEMRALVEEVAAQSDLVTARFDGDD
ARRPSFAIRTDDGRAEAVFAGLPMGHEFTSLILALLHVGGQARGARAGDELARGNRAAGG
HLGPVHRLLHVGGHPPKEDAELLDAVRALEGDFTFETFFSLSCQNCPDVVQALNIMAALN
PNIRHTAIDGALFQDEVERRKVMAVPAVFLNGEPFGQGRMDLAQIVAKLDTGAVARAAEK
IAAKDPFDVLVVGGGPGGAAAAIYAARKGIRTGIVAERFGGQVLDTLGIENFVSVQHTEG
PKLAAQLEAHVKDYDVDVMNVQEAAELIPGGATGLHEVKLKSGASVKGKTVILSTGARWR
QMGVPGEAEYRNKGVAYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGLVAHVTLIEFD
NQLRADAVLQTKLRSLPNVTVITSALTTEVLGNGEKVVGLRYRDRNKEEEHLVELEGIFV
QIGLIPNTEWLGDAVALSDRGEIEVDARGATSQPGIFAAGDVTTVPYKQIVIAMGEGSKA
SLSAFDHLIRAGV
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgctcgacgccaacacgaccgcccagctcaaatcctatctcggcaatctgcgc
cgtccgatcgaactggtcgcgagcctcgacgcctcgcccaagtcggccgagatgcgcgcg
ctggtcgaggaagtcgcggcgcagtcggacctcgtcaccgcacgcttcgacggcgacgac
gcgcggcggccctccttcgcgatccgcaccgatgacggccgcgccgaagccgtgttcgcg
ggcctgccgatggggcatgaattcacctcgctgatcctcgcactgctccacgtcggcggg
caggcccgcggcgcgcgcgccggcgatgaactggcccgaggcaaccgcgccgctggcggt
caccttgggccagttcatcgcctgctccacgtcggcgggcacccgccgaaggaagacgcc
gaactgctcgacgccgtgcgtgcgctggaaggcgacttcacctttgaaacctttttctcg
ctgtcgtgccagaattgccccgatgtcgtgcaggcgctcaacatcatggcggcgctcaat
ccgaatatccgccacaccgcgatcgacggcgcgctgttccaggacgaggtcgagcggcgc
aaggtgatggcggtgcccgccgtcttcctgaacggcgaacccttcgggcagggccgcatg
gacctcgcgcagatcgtcgccaagctcgacaccggcgcggtggcgcgcgccgccgagaag
atcgccgcgaaggatccgttcgacgtgctcgtcgtcggtggtggcccgggtggcgcggcg
gcggcgatttatgccgcgcgcaagggcatccgcaccggcatcgtcgccgaacgcttcggc
ggacaggtgctcgacacgctggggatcgagaatttcgtctcggtccagcacaccgagggg
ccgaagctcgcggcgcagctcgaggcgcatgtgaaggattatgacgtcgacgtcatgaat
gtgcaggaagctgccgagctgatccccggcggcgcgacgggcttgcacgaagtgaagctg
aagagcggcgcgagcgtcaagggcaagacggtgatcctgtcgaccggcgcgcgctggcgc
cagatgggcgtccccggcgaggccgaatatcgcaacaagggcgtcgcttactgtccgcac
tgcgacggcccgctgttcaagggcaagcgcgtcgcggtgatcggcggcggcaattcgggc
gtcgaagcggcgatcgatcttgccgggctcgtggcgcatgtgacgctgatcgagttcgac
aaccagcttcgcgccgacgcggtcctgcagacgaagctgcgcagcctgccgaacgtcacg
gtcatcacctcggcgctcaccaccgaagtgctcggcaatggcgagaaggtcgtcggcctg
cgctaccgcgaccgcaacaaggaggaggagcatctcgtcgagctcgaaggcatcttcgtc
cagatcggcctcatcccgaacaccgaatggctcggcgatgcggttgccctcagcgatcgc
ggcgagattgaggtcgatgcgcgcggcgcgacgagccagcccggcatcttcgccgcgggc
gatgtgacgacggtgccctacaagcagatcgtcatcgcaatgggcgaaggttcaaaggcg
tcgctgtcggccttcgaccacctgatccgcgcgggcgtgtag

DBGET integrated database retrieval system