KEGG   Uncultured Sphingopyxis sp. UC10: SPPYR_3430Help
Entry
SPPYR_3430        CDS       T05531                                 

Definition
(GenBank) Glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sphu  Uncultured Sphingopyxis sp. UC10
Pathway
sphu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sphu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SPPYR_3430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sphu02000]
    SPPYR_3430
Enzymes [BR:sphu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SPPYR_3430
Transporters [BR:sphu02000]
 Other Transporters
  Pores ion channels [TC:1]
   SPPYR_3430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_N_4 GST_C_3
Motif
Other DBs
NCBI-ProteinID: SBV34545
UniProt: A0A1Y5Q185
LinkDB All DBs
Position
SPPYR:3592290..3592928
Genome map
AA seq 212 aa AA seqDB search
MADDLIFYTNPMSRGQIARWMLEEVGAPYEPRILDYGTTMKDAAYLKVNPMGKVPAIVHN
GKTVTECAAICAYLADAFPEAGLAPDPADRADYYRWLFFTAGPVEQAITAKHFGIEPDAD
QQRMAGFGSLAAALDTLESAVAGKAFVAGDRFSAADVYVGSQIDWGLQFGTIAPRPAFEA
YVEPLRERSAYQRAKEIDNGLIAEMQAAGTAG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgacctgattttctataccaaccccatgtcgcgcggacagatcgcgcgctgg
atgctcgaagaggtcggcgcgccttatgaaccgcgcatcctcgattatggcacgacaatg
aaggatgccgcctatctgaaggtaaacccgatgggcaaggttccggcgatcgtccacaat
ggcaagaccgtcaccgaatgcgccgcgatctgcgcctatctcgccgacgcctttcccgaa
gccgggctcgctcccgacccggctgaccgcgccgattattatcgctggctcttcttcacc
gcgggccccgtcgaacaggcgatcaccgccaagcatttcgggatcgagcccgacgccgac
cagcagcgcatggccggcttcggctcgctcgccgcggcgctcgacacgctcgaaagcgcg
gttgcgggcaaggccttcgtcgcgggcgaccgcttcagcgccgccgacgtctatgtcggc
agccagatcgactgggggctgcaattcggcaccatcgccccgcgcccggcgttcgaggcc
tatgtggagccccttcgcgaacgttcggcctaccagcgcgcgaaggagatcgacaacggc
ctgatcgccgaaatgcaggcggcgggcacggcgggatga

DBGET integrated database retrieval system