KEGG   Uncultured Sphingopyxis sp. UC10: SPPYR_3500Help
Entry
SPPYR_3500        CDS       T05531                                 

Gene name
paaF
Definition
(GenBank) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sphu  Uncultured Sphingopyxis sp. UC10
Pathway
sphu00071  Fatty acid degradation
sphu00280  Valine, leucine and isoleucine degradation
sphu00281  Geraniol degradation
sphu00310  Lysine degradation
sphu00360  Phenylalanine metabolism
sphu00362  Benzoate degradation
sphu00380  Tryptophan metabolism
sphu00410  beta-Alanine metabolism
sphu00627  Aminobenzoate degradation
sphu00640  Propanoate metabolism
sphu00650  Butanoate metabolism
sphu00903  Limonene and pinene degradation
sphu00930  Caprolactam degradation
sphu01100  Metabolic pathways
sphu01110  Biosynthesis of secondary metabolites
sphu01120  Microbial metabolism in diverse environments
sphu01130  Biosynthesis of antibiotics
sphu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sphu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SPPYR_3500 (paaF)
   00650 Butanoate metabolism
    SPPYR_3500 (paaF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SPPYR_3500 (paaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPPYR_3500 (paaF)
   00310 Lysine degradation
    SPPYR_3500 (paaF)
   00360 Phenylalanine metabolism
    SPPYR_3500 (paaF)
   00380 Tryptophan metabolism
    SPPYR_3500 (paaF)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SPPYR_3500 (paaF)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SPPYR_3500 (paaF)
   00281 Geraniol degradation
    SPPYR_3500 (paaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPPYR_3500 (paaF)
   00627 Aminobenzoate degradation
    SPPYR_3500 (paaF)
   00930 Caprolactam degradation
    SPPYR_3500 (paaF)
Enzymes [BR:sphu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SPPYR_3500 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: SBV34615
UniProt: A0A1Y5Q1F7
LinkDB All DBs
Position
SPPYR:complement(3672419..3673201)
Genome map
AA seq 260 aa AA seqDB search
MTYETLLIEQRGAVTLVTLNRPQALNALNSSVLDDLIAAFAAFEADDSQRCAVLTGSGDK
AFAAGADIKEMADKPASDFYLEDFFSKWTSDFVKKVRKPWIAAVNGFALGGGCELAMMAD
FIIASDKAKFGQPEIKLGVAPGMGGSQRLTRAIGKAKAMEMCLTGRMMDAAEAERSGLVA
RVVAHETLVDEAVKTATTIAAMPPMAAMVNKDMVNAAFETTLDQGLIYERRLFQILAATE
DKAEGMAAFIEKREGVWKGR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgaaaccctcctcatcgaacagcgcggcgccgtaactttggtgacgctcaac
cgcccgcaggcattgaacgcgctcaactccagcgtgctcgacgatctgatcgccgccttc
gccgccttcgaagccgacgacagccagcgctgcgctgtcctcaccggctcgggcgacaag
gcgttcgcggcgggcgccgacatcaaggaaatggccgacaagcccgcgtccgatttctac
cttgaagatttcttctcgaaatggacgagcgacttcgtgaagaaggtgcgcaagccctgg
atcgccgcggtcaacggcttcgcactcggcggcggctgcgaacttgcgatgatggccgac
ttcatcatcgcatcggacaaggcgaaattcggtcagcccgaaatcaagctcggcgtcgcg
cccggcatgggcgggtcgcagcggctgacccgcgcgatcggcaaggcgaaggcgatggaa
atgtgcctgaccggccgcatgatggacgccgccgaagccgagcgctcgggcctcgtcgcg
cgcgtcgtcgcacacgaaacgctggtcgatgaagctgtgaagaccgcgacgacgatcgcc
gcgatgccgccgatggccgcgatggtgaacaaggacatggtcaacgccgcgttcgaaacg
acgctcgaccaggggctgatctacgaacgccgcctgttccagatcctcgccgcgaccgag
gacaaggccgagggcatggccgccttcatcgaaaagcgcgaaggcgtgtggaaggggcgg
tga

DBGET integrated database retrieval system